Entry information : CclPrx97 (clementine0.9_030230m)
Entry ID 8726
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: CclPrx97 (clementine0.9_030230m)
Name (synonym) CclPrx97 (clementine0.9_030230m)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx97
start..stop
S start..stop
CclPrx103 638 0 1..323 1..323
CsPrx23 629 0 1..323 1..323
CclPrx117 595 0 1..323 1..323
CclPrx85 587 0 1..323 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1233445..1233864 420 N° 2 1233123..1233285 163 N° 3 1232588..1232973 386  
complement(join(1232588..1232973,1233123..1233285,1233445..1233864))


exon

Literature and cross-references CclPrx97 (clementine0.9_030230m)
DNA ref. Phytozome 12:   scaffold_15 (1233864..1232588)
Protein sequence: CclPrx97 (clementine0.9_030230m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (293)
PWM (Da):   %s   34561.42 (31402.8)  
PI (pH):   %s   8.14 (8.20) Peptide Signal:   %s   cut: 30 range:30-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLSQTNKFTCTIFVSMLLLIISTQSEAQLSPTFYDATCPSALNTIRTGIRNAVSRERRMSASLIRLHFHDCFVQGCDASILLDDSSFIDSEKNALPNFKSARGFEVIDSVKSQLERVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASRSLAQNLPSFTDGLEKLISTFATKGLNARDLVALSGAHTIGQAQCAFFRDRIYSNQSNIDAGFASTRRRQCPANGGDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASDQVLFSGGSTDSIVDEYS*NPSKFKSDFAAAVIKMADISPLTGSAGEIRRVCNLV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Short 5' end is missing which has been completed; Stop in frame maybe due to bad sequencing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTTCTCAAACAAATAAGTTCACGTGTACAATTTTTGTCTCCATGTTGTTGTTGATCATCTCTACGCAATCTGAAGCACAACTCTCACCAACATTTTACGATGCCACTTGC
CCAAGTGCCCTCAACACAATCCGAACAGGCATTAGAAATGCTGTTTCACGAGAGCGTAGGATGTCGGCATCCCTCATTCGCCTCCATTTTCATGATTGCTTCGTTCAAGGTTGTGACGCG
TCCATTTTGTTGGACGATTCCTCCTTCATTGACAGCGAGAAAAATGCACTTCCAAATTTTAAATCAGCTAGAGGGTTCGAAGTTATAGATAGTGTCAAGTCTCAACTGGAAAGAGTTTGC
CCTGGAGTTGTTTCATGCGCTGATATCGTTGCTGTCGCAGCCCGTGATGCTTCTTTTGCT
GTGAGTAAATCATCATTAATTTTCTACAAGATTAATACAATAAGAGACATGGTGCTAACA
GAAATAGTGATAAGCCGATACCGTTCTCTATTATTAATCTTAATATATAATTCATTGTTAGTTTTGGTTAGTTAATTAATTTGAAAATATTAATTACAGGTTGGTGGACCATCATGGACT
GTTAAGCTTGGTCGAAGAGACTCAACAACTGCAAGCAGAAGCTTAGCACAAAACCTCCCCAGCTTTACAGATGGATTGGAAAAACTTATTTCCACCTTCGCTACCAAAGGCTTGAATGCA
AGAGACTTGGTCGCCCTTTCAG
GTACCCCTCTCTCTCTCTATACAAACATACATATGTGTGTGTGTATTTGTCACGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGTTTCATTTGAAATTCAGGAGCTCATACAATTGGCCAAGCACAGTGTGCATTTTTCCGTGATAGGATTTATAGCAATCAAAGCAATA
TTGATGCTGGATTCGCGAGCACTCGTAGACGTCAGTGTCCGGCTAATGGTGGTGACAGCAATCTATCACCACTTGATTTAGTAACACCCAATTCTTTCGATAACAATTACTTCAAGAATC
TCATTCAGAAGAAGGGACTTCTTGCATCAGACCAAGTTCTGTTTAGTGGTGGATCGACTGACTCCATTGTTGATGAATATAGCTAAAACCCTTCAAAATTTAAATCTGATTTTGCTGCTG
CCGTGATCAAGATGGCAGATATCAGTCCTCTCACTGGCTCTGCTGGAGAAATTCGAAGAGTTTGCAATCTTGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTTCTCAAACAAATAAGTTCACGTGTACAATTTTTGTCTCCATGTTGTTGTTGATCATCTCTACGCAATCTGAAGCACAACTCTCACCAACATTTTACGATGCCACTTGC
CCAAGTGCCCTCAACACAATCCGAACAGGCATTAGAAATGCTGTTTCACGAGAGCGTAGGATGTCGGCATCCCTCATTCGCCTCCATTTTCATGATTGCTTCGTTCAAGGTTGTGACGCG
TCCATTTTGTTGGACGATTCCTCCTTCATTGACAGCGAGAAAAATGCACTTCCAAATTTTAAATCAGCTAGAGGGTTCGAAGTTATAGATAGTGTCAAGTCTCAACTGGAAAGAGTTTGC
CCTGGAGTTGTTTCATGCGCTGATATCGTTGCTGTCGCAGCCCGTGATGCTTCTTTTGCT
GTTGGTGGACCATCATGGACTGTTAAGCTTGGTCGAAGAGACTCAACAACTGCAAGCAGA
AGCTTAGCACAAAACCTCCCCAGCTTTACAGATGGATTGGAAAAACTTATTTCCACCTTCGCTACCAAAGGCTTGAATGCAAGAGACTTGGTCGCCCTTTCAG
GAGCTCATACAATTGGC
CAAGCACAGTGTGCATTTTTCCGTGATAGGATTTATAGCAATCAAAGCAATATTGATGCTGGATTCGCGAGCACTCGTAGACGTCAGTGTCCGGCTAATGGTGGTGACAGCAATCTATCA
CCACTTGATTTAGTAACACCCAATTCTTTCGATAACAATTACTTCAAGAATCTCATTCAGAAGAAGGGACTTCTTGCATCAGACCAAGTTCTGTTTAGTGGTGGATCGACTGACTCCATT
GTTGATGAATATAGCTAAAACCCTTCAAAATTTAAATCTGATTTTGCTGCTGCCGTGATCAAGATGGCAGATATCAGTCCTCTCACTGGCTCTGCTGGAGAAATTCGAAGAGTTTGCAAT
CTTGTCAAC

Retrieve as FASTA