Entry information : SbPrx95 (Sobic.006G243600.1 [2.1] / SB06G030940 [1.4])
Entry ID 873
Creation 2005-12-16 (Christophe Dunand)
Last sequence changes 2005-12-16 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx95 (Sobic.006G243600.1 [2.1] / SB06G030940 [1.4])
Name (synonym) SbPrx95 (Sobic.006G243600.1 [2.1] / SB06G030940 [1.4])
Class Class III peroxidase    [Orthogroup: Prx154]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Roots
Inducers Acid treatment
Alkaline treatment
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx95
start..stop
S start..stop
ZmPrx91 599 0 5..321 4..321
SiPrx55 573 0 6..321 5..320
OsPrx57 541 0 1..321 1..319
BdiPrx133 500 2e-180 1..321 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59356319..59356531 213 N° 2 59355719..59355910 192 N° 3 59355050..59355610 561  
complement(join(59355050..59355610,59355719..59355910,59356319..59356531))


exon

Literature and cross-references SbPrx95 (Sobic.006G243600.1 [2.1] / SB06G030940 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_6 (59356531..59355050)
EST ref. GenBank:   CX614347.1 [5' end]   CN130548 [3' end]
Protein sequence: SbPrx95 (Sobic.006G243600.1 [2.1] / SB06G030940 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (297)
PWM (Da):   %s   34082.66 (31540.4)  
PI (pH):   %s   4.79 (4.62) Peptide Signal:   %s   cut: 25 range:25-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPCRQTFARYTMALLFAAAAVSAQLSTDFYGETCPDALDIIESAVRAAISKESRMGASLLRLHFHDCFVNGCDGSVLLDDTTGFTGEKTAKPNKNSLRGFDVVDDIKAQLEDSCQQTVSCADILAVAARDSVVALGGPTWDVELGRRDGTTASLDDANNDLPAPTLDLGDLIKAFAKKGLSANEMIALSGGHTIGQARCVNFRGRLYNETTSLDASLASSLKPRCPSADGTGDDNTSPLDPATSYVFDNFYYRNLLRNKGLLHSDQQLFNGGSADTQTTSYASDKAGFFDDFRDAMVKMGAIGVVTGSGGQVRLNCRKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, introns 1 and 2) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCTGCCGGCAGACCTTCGCCCGCTACACCATGGCGCTGCTGTTTGCTGCGGCTGCTGTCTCAGCGCAGCTCTCCACCGACTTCTACGGTGAGACATGCCCCGACGCGCTGGAC
ATCATTGAGTCCGCCGTGAGAGCCGCTATCTCCAAGGAGTCCCGCATGGGGGCCTCCCTGCTCCGCCTCCATTTCCACGACTGCTTTGTCAAT
GCAAGTGCCATTCATAAGCCGCCTCCA
GATTTTCTTTTTCTTTTCTTTTCTCGAGATTATCTAGTATTCAGTAATGAAGTTACATTAAACTTCCATATATGAGTCTGAACTGAATTAACGAACTCCAGTTAGATCTTCTCAACTTCT
ACTGTTTTAGGGAATTTTGCTTAGGCGTAGCATAACAGAGCATGCTGGTTCAGACGTCCAGTACTCAGTAGACAGTTTTACGTCGGTACTGTTAACTTTACGACAAGTCAGTTAAAAAGT
GGCGCGCACTCTGCCGCGTGCTTCGATTTTTCAAATCAAATTGTCTCTGTCGTTTCTAGAAGACGGTTTGCCTCTGAGTACAATGATGGAGTGTCTTTTCGTGGACTAACCGTTGACTGC
AATTGCAAACTGACTTTACAGGGCTGTGACGGGTCAGTGCTGCTCGACGACACCACGGGCTTCACCGGCGAGAAGACGGCGAAGCCGAACAAGAACTCGCTCCGTGGGTTCGACGTGGTT
GACGACATCAAGGCGCAGCTCGAGGACTCCTGCCAGCAGACGGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCC
GTAAGCACAGACACCAAGACTAGCTAG
CTGCATGCTTCTTCCATTTCATTTCCATGCATGGTTTACAAGCTAGCTAATTAACTGACAACCGTCTCCTGTGCATTGCAGCTCGGTGGGCCTACGTGGGACGTGGAGCTCGGCCGCCGT
GACGGGACGACGGCGAGCCTGGACGACGCGAACAACGACCTCCCGGCGCCGACCCTGGACCTCGGCGACCTCATCAAGGCCTTCGCCAAGAAGGGCCTGAGCGCGAACGAAATGATCGCG
CTGTCGGGCGGGCACACGATCGGGCAGGCGCGGTGCGTCAACTTCCGCGGCCGCCTCTACAACGAGACCACCAGCCTGGACGCGTCGCTGGCGTCGTCGCTGAAGCCGCGGTGCCCGAGC
GCGGACGGCACCGGCGACGACAACACGTCGCCGCTGGACCCGGCCACGTCCTACGTCTTCGACAACTTCTACTACAGGAACCTGCTGCGGAACAAGGGCCTGCTCCACTCGGACCAGCAG
CTCTTCAACGGCGGCTCCGCGGACACGCAGACCACCTCCTACGCGTCCGACAAGGCCGGCTTCTTCGATGATTTCCGCGACGCCATGGTGAAGATGGGTGCCATCGGCGTCGTCACTGGG
TCCGGAGGGCAGGTCAGGCTGAACTGCCGGAAGACGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCTGCCGGCAGACCTTCGCCCGCTACACCATGGCGCTGCTGTTTGCTGCGGCTGCTGTCTCAGCGCAGCTCTCCACCGACTTCTACGGTGAGACATGCCCCGACGCGCTGGAC
ATCATTGAGTCCGCCGTGAGAGCCGCTATCTCCAAGGAGTCCCGCATGGGGGCCTCCCTGCTCCGCCTCCATTTCCACGACTGCTTTGTCAAT
GGCTGTGACGGGTCAGTGCTGCTCGAC
GACACCACGGGCTTCACCGGCGAGAAGACGGCGAAGCCGAACAAGAACTCGCTCCGTGGGTTCGACGTGGTTGACGACATCAAGGCGCAGCTCGAGGACTCCTGCCAGCAGACGGTCTCC
TGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCC
CTCGGTGGGCCTACGTGGGACGTGGAGCTCGGCCGCCGTGACGGGACGACGGCGAGCCTGGACGACGCGAACAAC
GACCTCCCGGCGCCGACCCTGGACCTCGGCGACCTCATCAAGGCCTTCGCCAAGAAGGGCCTGAGCGCGAACGAAATGATCGCGCTGTCGGGCGGGCACACGATCGGGCAGGCGCGGTGC
GTCAACTTCCGCGGCCGCCTCTACAACGAGACCACCAGCCTGGACGCGTCGCTGGCGTCGTCGCTGAAGCCGCGGTGCCCGAGCGCGGACGGCACCGGCGACGACAACACGTCGCCGCTG
GACCCGGCCACGTCCTACGTCTTCGACAACTTCTACTACAGGAACCTGCTGCGGAACAAGGGCCTGCTCCACTCGGACCAGCAGCTCTTCAACGGCGGCTCCGCGGACACGCAGACCACC
TCCTACGCGTCCGACAAGGCCGGCTTCTTCGATGATTTCCGCGACGCCATGGTGAAGATGGGTGCCATCGGCGTCGTCACTGGGTCCGGAGGGCAGGTCAGGCTGAACTGCCGGAAGACG
AACTAA

Retrieve as FASTA