Entry information : CpapAPx03 (evm.model.supercontig_6.282)
Entry ID 8731
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapAPx03 (evm.model.supercontig_6.282)
Name (synonym) CpapAPx03 (evm.model.supercontig_6.282)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx03
start..stop
S start..stop
ThasAPx06 417 8e-149 1..277 1..277
AhalAPx03 409 1e-145 1..277 1..277
CrubAPx04 405 2e-144 1..277 1..277
TsAPx04 405 5e-144 1..272 1..272
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2152836..2152945 110 N° 2 2152508..2152632 125 N° 3 2152179..2152228 50 N° 4 2151975..2152040 66
N° 5 2151858..2151903 46 N° 6 2151592..2151674 83 N° 7 2151396..2151475 80 N° 8 2151169..2151271 103
N° 9 2150800..2151021 222  
complement(join(2150800..2151021,2151169..2151271,2151396..2151475,2151592..2151 674,2151858..2151903,2151975..2152040,2152179..2152228,2152508..2152632,2152836. .2152945))


exon

Literature and cross-references CpapAPx03 (evm.model.supercontig_6.282)
DNA ref. Phytozome 11:   supercontig_6 (2152945..2150800)
Protein sequence: CpapAPx03 (evm.model.supercontig_6.282)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   294
PWM (Da):   %s   32727.98 Transmb domain:   %s   o256-275i
PI (pH):   %s   8.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVKVDSEYRKEIEKARRDLRALISSKNCAPIMLRLAWHDAGTYDAKRRTGGPNGSIRFEEEYKRPANLGLENAVAIEEVKRKHPRITYADLYLAGIVAVEVTGGPEIDFVPGRKDADCPDEDGLPDANQGVSHLKNIFYRMGLSDKDIVALSGGHTGRAHKDRSGFDGPWTSDPLKFDNSYFVELLKGTSAGLLQLNTDKALLAAPEFRQYVESYADEDAYFRDYAVSHKKLSELGFITPPPKVSRTLARVLWHAITVAVVILSLFFAFSKRRQNLACLILFKTCPNIV*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGAAAGTGGACTCAGAGTACCGAAAAGAAATCGAGAAAGCTCGACGAGACCTTCGCGCTCTCATCTCCAGCAAGAACTGCGCTCCTATCATGCTTCGCTTAGCGTAATTCATG
TTTTTTTTTTTTTTAATTTTTTAAAAATTATTGTTTTGTAGTTGTTAACGGAGCTGAGAAACATGATATATTCATAATTCATCTTGTTGATTGTATCCTAAACTGTGTAAGGTCGTATTG
GTTGCAGTTTGGTGAAAATTAGATACTAAAATGGACAACGTTAAATGAAATTTCTTTTTTGCTTCCATGAAAGGTGGCATGATGCTGGAACTTACGACGCTAAAAGAAGGACAGGAGGTC
CTAACGGTTCCATAAGGTTTGAAGAAGAGTACAAGCGCCCTGCAAATTTGGGATTGGAGAATGCAGTTGCCATTTGTG
GTGAGACCTAGCTCCTTTAACATTATTGCGTTTTGCAAACAA
GTCCTTCTAGTTGAGACTTTAGATTGAATTTCTAATCTAGATTTGAAGCACCCCATTTGGTAATTAACTTGTTTTGACTCCATGGCTATGTTATTTGCTGCTTCTACAATGTTTGGCAGA
TTTAGAAACTTTTATGTCTTGCAAGGGAATCGTGTTGTTGGACTTCATATCTAAGGAGATGATTTTGTAGTTTATATTTTTATATTTTAACTATTTCTGGCTCCATTTTTATTTCAGAAG
AAGTGAAAAGGAAACATCCAAGGATTACATACGCTGATCTCTACCAG
GTAAGTAGATTTTAAAGTGAGGAAACACTATATCTACTCAGATTTTTTAATGGGTTCATCTTTACAGAACATG
ACATAACAAAAGTAGTTTCAGTTCTTCATTCAGACTTGATTGCTGTTTCTTTGGAAAATTTCCAGCTTGCTGGAATAGTTGCAGTTGAGGTCACAGGAGGCCCTGAAATTGACTTTGTTC
CTGGTAGGAAG
GTAATGTTTCATAGGCTTGATCACCAGGTTATATTGCTCTTTACTAAGCCCCCCCTTTTACTGTCAATCAGGATGCGGATTGTCCTGATGAAGATGGGCTTCCCGATGC
CAATCAAG
GTTTATTACTAACTATAACTGGTGTCATTTTAATCTCTAGTACTTTCCAGAAGGTTGCGCGCCATAATTCATAAGCTTCCAAAAGATATATTGGGATGTTTAAACTCAAGTT
TTTATGCTAGGCTTGATCTCTTACCAGTTTAAACTCCTGAAAATTTTGGCACATCTTTAAATTTAATGCAGGTGTATCACATCTCAAAAACATTTTTTATCGAATGGGTCTATCTGATAA
GGACATAGTGGCATTGTCTGGAGGACACACATTG
GTAACATTTTCAGACATATTCAACAATCAAGCCGAAGTCCACCACTTTTTCCAAACATACAAACATATAGTGCTTGCACTTCTTTC
TTGTTACTTCTTAATTATCTGGTTTTGTAGGGAAGAGCACATAAAGATAGGTCAGGATTTGATGGTCCCTGGACAAGTGACCCGCTCAAGTTTGACAACTCATACTTTGTGTAATACATA
AGATCTTTGATATTTGATTAATTCCATGAAACAATCAAATTATATTTAATTGGAAGAAATGAATTGGAATTTTATTTTAAGCATCACAAAATGTATGATGTTTATGCTCATCAGGGAACT
ACTGAAGGGAACCTCAGCCGGCCTACTACAGCTTAATACTGACAAAGCTCTTTTGGCTGCTCCCGAGTTCCGGCAGTATGTGGAATCATATGCAAAG
GTACATAGCTTGACATGAAATTC
TTGTGTGTAGTATGTGTATGAAGTAGATTGCCTTTGAACTGTGTATGTGATAGCAGACCATTAGAATTTTGGTACAAGTCGGACAGATATGACTGAAGATTTTCTTCTAACCTGTATTTG
GCAGGATGAGGATGCATACTTTAGGGATTATGCAGTCTCGCACAAGAAACTTTCCGAGTTAGGCTTCATCACTCCACCACCAAAGGTTTCCAGGACACTGGCACGTGTACTTTGGCATGC
GATTACTGTAGCTGTGGTGATCTTAAGTTTATTCTTTGCATTTAGTAAAAGGAGACAAAACCTCGCATGCTTAATTCTTTTCAAGACATGCCCAAATATTGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGAAAGTGGACTCAGAGTACCGAAAAGAAATCGAGAAAGCTCGACGAGACCTTCGCGCTCTCATCTCCAGCAAGAACTGCGCTCCTATCATGCTTCGCTTAGCGTGGCATGAT
GCTGGAACTTACGACGCTAAAAGAAGGACAGGAGGTCCTAACGGTTCCATAAGGTTTGAAGAAGAGTACAAGCGCCCTGCAAATTTGGGATTGGAGAATGCAGTTGCCATTTGTG
AAGAA
GTGAAAAGGAAACATCCAAGGATTACATACGCTGATCTCTACCAG
CTTGCTGGAATAGTTGCAGTTGAGGTCACAGGAGGCCCTGAAATTGACTTTGTTCCTGGTAGGAAGGATGCGGAT
TGTCCTGATGAAGATGGGCTTCCCGATGCCAATCAAG
GTGTATCACATCTCAAAAACATTTTTTATCGAATGGGTCTATCTGATAAGGACATAGTGGCATTGTCTGGAGGACACACATTG
GGAAGAGCACATAAAGATAGGTCAGGATTTGATGGTCCCTGGACAAGTGACCCGCTCAAGTTTGACAACTCATACTTTGTGGAACTACTGAAGGGAACCTCAGCCGGCCTACTACAGCTT
AATACTGACAAAGCTCTTTTGGCTGCTCCCGAGTTCCGGCAGTATGTGGAATCATATGCAAAG
GATGAGGATGCATACTTTAGGGATTATGCAGTCTCGCACAAGAAACTTTCCGAGTTA
GGCTTCATCACTCCACCACCAAAGGTTTCCAGGACACTGGCACGTGTACTTTGGCATGCGATTACTGTAGCTGTGGTGATCTTAAGTTTATTCTTTGCATTTAGTAAAAGGAGACAAAAC
CTCGCATGCTTAATTCTTTTCAAGACATGCCCAAATATTGTGTGA

Retrieve as FASTA