Entry information : CpapAPx07 (evm.model.supercontig_37.148)
Entry ID 8735
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapAPx07 (evm.model.supercontig_37.148)
Name (synonym) CpapAPx07 (evm.model.supercontig_37.148)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx07
start..stop
S start..stop
CrubAPx03-1 310 2e-107 1..226 1..287
CagraAPx03-1 308 6e-107 1..226 1..287
BstrAPx03 308 6e-107 1..226 1..287
CclAPx03 307 2e-106 1..226 1..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1221582..1221694 113 N° 2 1221837..1221961 125 N° 3 1222641..1222690 50 N° 4 1223870..1223935 66
N° 5 1224015..1224063 49 N° 6 1225774..1225856 83 N° 7 1226323..1226517 195  
join(1221582..1221694,1221837..1221961,1222641..1222690,1223870..1223935,1224015 ..1224063,1225774..1225856,1226323..1226517)


exon

Literature and cross-references CpapAPx07 (evm.model.supercontig_37.148)
DNA ref. Phytozome 12:   supercontig_37 (1221582..1226517)
Protein sequence: CpapAPx07 (evm.model.supercontig_37.148)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   24656.68 Transmb domain:   %s   o197-219i
PI (pH):   %s   7.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPIVDADYLKEIDKARRDLRALIACKDCAPIMLRLAWHDAGTYDASTKTGGPNGSIRNEEEYSHGANSGLKIALDFCEQVKAKHPKITYADLYQLAGVVAVEVTGGPTIDFVPGRRDSMVSTKEGRLPDAKQVAFHNKFSTMHIVLITSALVRPTFAILEDEDAFYRDYAESHKKLSELGFSPRSSGSKGTSDSIILAQSAVGVAVAAAVVILSYFYEVRKRMK*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Gaps in frame due to the 'NNNNN' in DNA sequence).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCCCATCGTCGACGCGGACTACCTCAAGGAGATCGACAAGGCTCGCCGCGACCTCCGTGCTCTAATCGCCTGCAAGGACTGCGCTCCCATCATGCTCCGCTTGGCGTACGTT
TTTCTCACTCACTCTTCCTTTTTTTGTTTGTTTCTTTGGTTCCGAGGAGAGTTATGACAGGAGAAGAAGAACAAGGACATTGAAGCTTATACTGCAAGCTTATGACAGAAGACGGCTCTG
TGTTTTGTTATGAAGGTGGCACGATGCAGGGACTTATGATGCGAGCACAAAGACTGGTGGACCTAATGGCTCCATAAGGAACGAAGAAGAGTACTCCCACGGAGCCAACAGCGGCTTGAA
AATCGCTCTTGATTTTTGTG
GTGTGCTTACTTGTTTCTTGCTTTCTTTTCATTTTCGTCCCTTTTGTCACATCGAAATGTTTGTCATTTCACTTTCTTATACTTTAATTTACAGATAGGT
GATGCTCAGATATAGGCCATTTTTCGGTTTCTTTTGTGATAAAAAAATTGACTAAATAATATTTTGGCATTTCGAGGTTGCAGTTTGCTTCCGAGCGGATACGATAAATAACTGCTTCTT
AGCAATATTGATGCTTACTAAAAATTAGATTCTGTTCTCTCGGTGAATCGAATGGATAGCATCTATTAAAGATTGGTATCTCGTTATAAAATGTCTATTTTAGTCATCATTTGGGTTCCT
AGTTCTTTATATTTTCTTCAGTTTTCATTATTGCAAGAAAATGATTGTATTTGTTACCTTGGTAAGTAAATGAGGGGTTGATATCCAAATAACGTTCACCTTGTCTTAGCTTGGTAGTGA
AATCTCTCTGTTAACATGATTAAAAGTTCCATGGTCTAAGAACTAAGCAAGGTAAGAGAGGCTGGTAATGTTAGATGATTAGTTTGGTTATTTTGTATCTTGGACCATCATGCTTGTGGT
GTTGAATGAATGTCCTATGGAATTTTGTATTAATTTGCAATGTCTATGATTAATTTGATTTGAATTTGTAATTAAATGGTGCTTTTTCTCAATATGCAGAGCAAGTGAAAGCTAAACATC
CTAAGATTACATATGCTGACCTGTATCAG
GTGATGACCAAATTGGCAACTCTTTGTTCTAATTATTAGCGAATTAATGGATTTCTTACAGAAACCAGGACGTCTATAATGAGCATGCGAA
TACCTTTTTCTTTTCCCTGGTACAATTTGGATTTCTTCGATGGAAAATATAAGTGAAAGCTGTTACAGAATCTGGAACCATGGTATAATGCCTTTGCAAATCATGCTTGGTAGAGAAACA
ATCTTTCTTATTAATTTTTCAATGCATTTAAACATTCAGGTGCAGGTACATATCCTAGATATGAGTCTAACATTAACTTACAGGAGTCTGATGCTGAAGTTGCCCTTTTGAACTCCAGTA
TAAGAAGGGTTTCCTATTGAATTATTGTCATGTCAGTCCATGGAATCATTTTATTCTTAGTTCCTTCAAAATTTTGGATGTTTTATGCCTTTGTTATTTTCGTGCTATGTGTTCTAAGTT
CCGCAATTTGTTTCTGAACTATGGCCTTTTACAACTTATTCCAGGTGGTTAAACTGTAGAACCGAACTAAACTTGAGTTAATTGGAGTAATCTGGTAGGATCCAGAGACTAGAATTCAAA
CATTGGAAAGACTAATTATCTTTTGAGTAGAAAAATGCTTAGGTCTTATGTTTTTATAATGTTGAAGCTGCGAGTTTTACTATGATCTCGGGTAAGAAAAATGATGTTTTGAGGAATTAT
TGATGCTGTAACAACTATACAAAGAAGGGTACAATTTTGCACAGGGGTTATCTGTTCTGTATGCAAATGAGTGAGATTCCTGTTTATGCTAAAACTACTTCCAGACATTCAGTTAAATAA
TGACTGCAAAGAAACAAAGAAGGAATTTGATCATGTTAAATGAAACCATGTTTTGGATTTACCATTGATTTAGACTTTAAACCATATTGACATTCTAGACTTTTTAACAGAGCTGTTATT
TGGTTTCTTCATGTCCACAACAGATCCTCGCTAATGACTTGAGTATTTATTTGGTGTAATTTTTATTTCAAAAAAATTTATTTTTGGTGTAATTTAATCAAAAGAATAATGCATCAGTAT
GGTGGTTAATCCACTTAAGACCTTTTTGACCGTGTGTATCTGAGGAATGACAGATGCTAACATAATAAATTTGCTACATTAGGAACTGAATACTGAGCTGATACATTATAAATGTGTTCC
TATTTCAGCTTGCAGGTGTTGTTGCAGTTGAGGTCACTGGAGGCCCAACCATTGATTTTGTTCCTGGTAGACGAGTATGTTCCTGTGGCTATTTTGAAATATAATTTACTGAAGATTTGC
TGCATTATATTAACTTCATGTCTCTTTTATCAGGATTCAATGGTTTCTACCAAGGAAGGACGATTGCCAGATGCGAAACAAGGTGATACTTACTTTTTGAATTGTCTGTAGCTTAAAATT
ATGAAGGTGTTTGTGGTAAAGGATTTTCAGTTTTCTCTTTGCTTGATATCATGTGTCACAACTAGTTCATAGCTCTTGAAAAGATACATATCCAGAAGATTTGGTGGTCCTGGATGATGC
ACATACATATTTGTGGTGTAGTGATTGTTCCAAGTAGAAAATGTGTGTGAGAATGCTTCTCCAGGTATGGTAATAAGCATGACGTTCAATTAGGTTAATGTCAACAGTTCCAGGTCATCA
CTTGGCTGCTTTCTGCAGTTTCAGTTTCTGCTGGATTTGTCCTAAACTCATGGACTAGATTAAAACATGACCATTTGGTTTCGTAGTTCCCTGATCATAAGCTGAATGCCTTTTTAAGAA
TGTTTTATCATTGAGGCGCTCAGTGGTGTAGCGGAGATTTGCATGCATATCTTTTGACATGCCTTTGTGAAGCCACGGGGCAGATTCTCTGGAATCTCTCTAGCAAACTGCCACTGTGCC
TCTTACTACCCCTCCACTTATGCTGGATGTTAGGAGCATCTTCATTTGTAGGCATCACATCAGCCAGCAGGCTATATCTCTTAGAGGATCAGTTGTAGCAATTACCCGCAAGCCTATGGG
ATAGTTGATGCTTCCAAGTTCTCTGAATGGAACTTTTTGATCTGGGTTTGATCTTTGTAAAGACAAAATTCTGATCACAAAAAAAAAAATAATAATAAATAAAGAGTTATCTTCAAGAAA
AATAAATAAATAAATAAAAGAAAGAGATAAGCAAACATGGAACCTATAATATCTCTTCTAAGAAGGAAACTATAGTATCTTTTTCTCAAGCACTCTTGTAATTTCTTAGTACAGCCATAA
AAAGATTGCAAGACAACATGGAGTGCAAAAATAAAAAAATAGATAAAAGAAAGAGATAAGCAAACAAGGAACCTATAATATCTTTTTCTCATTCTTATAGTTTCTTAGTGCTGCCATAAA
AAGGTTGCAAGACAACACGGAGTGCTCTTAAAAACCTGTAAAAGCTGAACTGAGGTTTGCTTTAATTTTCAAGTCTTCATTTGTTTGGTTTTGGTGATAAAAGAATGTCTGCTTTCCTCT
CCTTTTCTCTATAAACTTGTTTGTGGGAGTCTCATGACTCGAGTGAATTGTTTGAAGGTGGGCATTGTCATGTATTTATGTTGTTGATGGTATCATGTTGGTCTTATACTTTCCATTTTT
CTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAGGAGTACATA
GTTTCTAGACTGAATCTCTCCTCCCCACATTTTATGCATGGCGCCACTCTGAGGAGTACATAGTTTCTAGACTGAATCATCTCTTTGACTTGTTTGCCTGCTTAATAAGCAGTGGCATTT
CATAATAAGTTTTCCACAATGCACATTGTTCTCATTACAAGCGCTTTGGTACGCCCTACCTTTGCAATACTAGAG
GTATTTGTGGATTCATGTTGAACCATCATTCAAACATGTGTTTTT
GGATTCAAAGTTTTGATTTGACCTACCAGACCTGGGCCCACCAGTTGTTGTCTTATAAGTTTTATGATAATATCAAGACATTTAGATTTTTTTCAGATGTTTCCCTGACTTTGTTTCAAA
ACAACATTTAGTCAATAGTTTGGATGCCCTTGTTTATTAGTTGGGTCTTGTTTCAGCTTTCAAGTGTGCCAATAGGATGATAATGCTTGAGCCATCATTCAAATCGTTGCTTCATGCTTG
CTCCCAATATAAAGCACAATTGGGTCAAAAGTATGCAGTCAGTTGCCAACTACCATGTGGCATAATGCTTTTACAAGACCCAATCAATTTTATTCTTGTTCCTTTTTTCTTTCCTCATTC
CAGAATTATCTCAAATAATATTTTCATTTATTTATTCTTCTTAATTAATTCCATGTGTCAGGATGAGGATGCATTCTACAGAGATTATGCAGAATCACATAAGAAACTTTCGGAACTTGG
ATTTAGTCCCAGATCCTCTGGTTCCAAGGGAACTTCGGATAGTATCATATTGGCACAAAGTGCTGTTGGAGTTGCAGTGGCTGCTGCCGTGGTGATTTTAAGCTACTTCTATGAAGTTCG
CAAAAGAATGAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCCCATCGTCGACGCGGACTACCTCAAGGAGATCGACAAGGCTCGCCGCGACCTCCGTGCTCTAATCGCCTGCAAGGACTGCGCTCCCATCATGCTCCGCTTGGCGTGGCAC
GATGCAGGGACTTATGATGCGAGCACAAAGACTGGTGGACCTAATGGCTCCATAAGGAACGAAGAAGAGTACTCCCACGGAGCCAACAGCGGCTTGAAAATCGCTCTTGATTTTTGTG
AG
CAAGTGAAAGCTAAACATCCTAAGATTACATATGCTGACCTGTATCAG
CTTGCAGGTGTTGTTGCAGTTGAGGTCACTGGAGGCCCAACCATTGATTTTGTTCCTGGTAGACGAGATTCA
ATGGTTTCTACCAAGGAAGGACGATTGCCAGATGCGAAACAAG
TGGCATTTCATAATAAGTTTTCCACAATGCACATTGTTCTCATTACAAGCGCTTTGGTACGCCCTACCTTTGCAATA
CTAGAG
GATGAGGATGCATTCTACAGAGATTATGCAGAATCACATAAGAAACTTTCGGAACTTGGATTTAGTCCCAGATCCTCTGGTTCCAAGGGAACTTCGGATAGTATCATATTGGCA
CAAAGTGCTGTTGGAGTTGCAGTGGCTGCTGCCGTGGTGATTTTAAGCTACTTCTATGAAGTTCGCAAAAGAATGAAGTGA

Retrieve as FASTA