Entry information : CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Entry ID 8736
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Name (synonym) CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx[P]-R
start..stop
S start..stop
PtAPx-R 229 1e-75 29..208 31..213
VvAPx-R 221 3e-72 64..208 55..206
RcAPx-R 219 1e-71 17..207 11..203
MeAPx-R 207 9e-67 29..208 29..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5822..5999 178 N° 2 5525..5630 106 N° 3 5038..5165 128 N° 4 4601..4671 71
N° 5 4350..4392 43 N° 6 4159..4259 101  
complement(join(4159..4259,4350..4392,4601..4671,5038..5165,5525..5630,5822..599 9))


exon

Literature and cross-references CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
DNA ref. Phytozome 11:   supercontig_217 (5999..4159)
Protein sequence: CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208
PWM (Da):   %s   22146.63  
PI (pH):   %s   9.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLSIFKPSPLCSLRTSPTFQINFNSDSPAKPLRSSSPTVKYGARLLHACALPSPDDQSGTGKNQFCVSNRRKVLLGSTLPFLIPLERFGVQAAESGTATYSLIKEEVRKLLTKSKAAGVLRLVFHDAGTFEMDENGGMNGSILYELDRPENSGLKKSIILNKAKTEVDAVQPVSWADVIAVAGAEAVLVCGGPTIPVLIGRLDSM

Retrieve as FASTA  
Remarks partial sequence from genomic. Incorrect prediction from Phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTGAGTATTTTCAAACCCTCACCACTATGCTCTTTACGAACCTCTCCCACTTTCCAAATCAATTTTAATTCCGATTCTCCCGCCAAACCTCTGAGGTCATCTTCCCCAACTGTC
AAATATGGCGCCAGACTCCTTCACGCCTGTGCTCTCCCCAGCCCCGACGATCAATCAG
GTTAAAATACTTGTTCGTCGTTTAATTTTTTTCCAGTCTCGACTGTGTCTCCCGAGAAATTC
ACGGGAATTTTGAGACTATGAAAACTGTCCCACTAAAAAGTATTTGTCTTTATGTATAAACCAAAACCTTCTTCCCTTGAAATTGCCCGATGTGTTTGGTTTGTTTCTTATTCCATTTAT
TTGCTTTAGGTACAGGGAAAAATCAATTCTGTGTTTCCAATAGGAGGAAAGTGCTATTAGGATCCACACTGCCATTTCTTATTCCTTTGGAGCGGTTTGGAGTTCAGGCGGCTGAGTGAG
TATAGCAAATCTCTCTCTCTCTCTCTCTTATTACTATTATTTCCATTTCTTCTGAAGTATGAGGTGTGGAATTTACATATAATTATACTAATTGCATGGTAACGTAATCCCAATTGGACT
AAACCCAAGCATCAACGGGTTTCAGATTATCTTTAGGCGTTGCTACAGGTTTTATCAATGACTAGACGACTGTTTTTGCTTATCGAACATTTATGTTTGGATGATAATGCATCAGGGCAC
TGGCTAGGAGATGTATAAACTATTGCATTGGGTTCAAATGTCTGTGGGTTATCTATCATTGTGATGCCTGCCTTATATCATATTCAATTTGCCTTGTTACCATTGAAATTGAAGGTCGGG
TACAGCAACATATTCATTGATAAAGGAAGAGGTAAGGAAGCTATTGACCAAAAGCAAGGCTGCTGGTGTGCTTCGGCTTGTTTTTCATGATGCGGGCACCTTTGAAATGGATGAGAATTC
AG
GTATTTGTTCGTGGAATGATCATTGAGGTATTAGATCTAAATGGCATTGATTTCTAAATGAAACATGGATCTAGTTTTTATACTCCTCCGCATAAAAGCATATGATAGCTGCTTCTTA
GGACATTGAGACAGTTTATAGTCAGTGTACCACTGCTTCCAATTTTGATATTTTATTTCCTTGTGCCAGCGAAAGCTTGATAGTAGTTGGATTAATATTCTTATTGGTTGTTGGGTGACA
TTCAAAACTTCTTTCATTTCATTAAGTAAATATCAATTTTTTCTTTTGGTTTCCTATCTTCTAAGTTCATTAGTAATATGGGGTTTCCCTTGTTCATGTGAATTTATTACATGCTTATGT
AACTGCAGGGGGTATGAATGGTTCTATACTCTACGAACTTGATAGACCTGAAAATTCAGGTTTGAAGAAATCTATAAGGCATGGGCACTTTCTCTCTTGCTTTCCTGTATGGTTGAAATG
TATGTGCATCCTATTTTTCTATCCGTAAATACATACTATATATGCTGCATGGCTTTTGCTTTTCCATACCTCCTATAGATTTCCGAACTCCTTAATACATATACAAAACTGGATAAATCT
CGTAGAATCTCCTAACAGCTAACTCCTAGTGGTACATTGTTATCTAGATTCTAAACAAAGCAAAGACTGAAGTAGATGCAGTACAACCAGGTAATTGTCTTTTGAATGGCCAGTAAACTA
GATATTTTTATTATTGGAACTACAGCACCATGCTAATATTCCAGGCTCTCCCATTATTAGTGTCCTGGGCAGACGTGATTGCTGTGGCTGGAGCTGAAGCTGTGTTAGTTTGTGGTGGAC
CAACAATCCCAGTTCTTATAGGCAGATTAGATTCGATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTGAGTATTTTCAAACCCTCACCACTATGCTCTTTACGAACCTCTCCCACTTTCCAAATCAATTTTAATTCCGATTCTCCCGCCAAACCTCTGAGGTCATCTTCCCCAACTGTC
AAATATGGCGCCAGACTCCTTCACGCCTGTGCTCTCCCCAGCCCCGACGATCAATCAG
GTACAGGGAAAAATCAATTCTGTGTTTCCAATAGGAGGAAAGTGCTATTAGGATCCACACTG
CCATTTCTTATTCCTTTGGAGCGGTTTGGAGTTCAGGCGGCTGA
GTCGGGTACAGCAACATATTCATTGATAAAGGAAGAGGTAAGGAAGCTATTGACCAAAAGCAAGGCTGCTGGTGTG
CTTCGGCTTGTTTTTCATGATGCGGGCACCTTTGAAATGGATGAGAATTCAG
GGGGTATGAATGGTTCTATACTCTACGAACTTGATAGACCTGAAAATTCAGGTTTGAAGAAATCTATA
AGG
ATTCTAAACAAAGCAAAGACTGAAGTAGATGCAGTACAACCAGTGTCCTGGGCAGACGTGATTGCTGTGGCTGGAGCTGAAGCTGTGTTAGTTTGTGGTGGACCAACAATCCCAGTT
CTTATAGGCAGATTAGATTCGATGTAA

Retrieve as FASTA