Entry information : CpapPrx01 (evm.model.supercontig_1040.1)
Entry ID 8737
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-05 (Qiang Li)
Peroxidase information: CpapPrx01 (evm.model.supercontig_1040.1)
Name (synonym) CpapPrx01 (evm.model.supercontig_1040.1)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx01
start..stop
S start..stop
PpePrx77 501 2e-180 11..337 13..341
GrPrx02 499 9e-180 15..337 10..337
QrobPrx02 498 3e-179 27..337 23..335
ThasPrx46 492 1e-176 8..339 4..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4515..4772 258 N° 2 4878..5057 180 N° 3 5418..5577 160 N° 4 6471..6892 422
join(4515..4772,4878..5057,5418..5577,6471..6892)


exon

Literature and cross-references CpapPrx01 (evm.model.supercontig_1040.1)
DNA ref. Phytozome 12:   supercontig_1040 (4515..6892)
Protein sequence: CpapPrx01 (evm.model.supercontig_1040.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (310)
PWM (Da):   %s   37393.37 (34178.6)  
PI (pH):   %s   8.7 (8.70) Peptide Signal:   %s   cut: 30 range:30-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKRDQPAVTILPLLALAVLSFLPADVKAATSLPTPVKLQWHYYKVHNTCDDAEAYIQYQVKRFWQSDKSITPKLLRLLYSDCLVTGCDASILLDVPNSEKTAPQNIGLGGFVVIDKIKTVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVFTGRRDGMKSMAASVDLPSPSISWEAALAYFTSKGLDILDLTTLLGAHSMGRTHCSHIVDRLYNFNNTGKPDRSIAASFLAELRKLCPKTQKGQTDLLVFLNPESGSNYTFTSSYFSRVLSKKVVLGVDQQLLFGDITKEIVTELQGFEDFRKSFALSMSRMGNLNVLTGGKGQIRRDCRYINPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Two ESTs. lab_host="E. coli". tissue_type="leaf, root, stem, flower, fruit, and seed". Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAAGAGATCAACCAGCAGTTACGATCCTTCCACTGTTGGCTCTTGCAGTATTAAGCTTCTTGCCGGCAGACGTGAAGGCCGCCACGTCGCTGCCGACACCTGTGAAGCTCCAA
TGGCATTACTACAAGGTCCACAATACATGTGATGATGCCGAAGCTTATATACAGTACCAAGTGAAAAGGTTTTGGCAGTCTGACAAGAGCATCACACCTAAGCTACTTCGCTTGCTCTAC
TCGGATTGTTTAGTAACC
GTAAGTCTCTTTCTCTTGTTTTATTTTTGATACGAGACTTCATTTGCTTTCCTAATCTTCCTAATCAATCATGGATGGATCTAAATCATGGTCAACCAAATG
TAGGGCTGTGATGCATCTATTCTACTAGACGTGCCTAACTCGGAGAAGACTGCACCACAGAACATAGGCCTTGGAGGGTTTGTGGTGATCGACAAGATCAAAACTGTTCTTGAGCAGCGG
TGTCCTGGAGTAGTTTCTTGCGCTGATATTCTAAATCTTGCCACTAGAGATGCTGTTCACTTG
GTAAAAGCATCTCTTACATAATCTCCCATACGGACTTTTCATTATATTCTAAGTGGT
TATTGATAGAAACCTAGATAGTGTTTTGTTAGCATATAGTACCAGCACAGCTTGGTATAATACAAATTTATTATAGTTTTGTTCCCTACTATTTTTGGTAGCTTAAAATTTTGATATTGA
ACAATACCATAGATTTGTATGGTCTTACCGTAGATTTGTATGGTGTTGTAGAATAAAGCTACCAAATGCTGCCTGGTGTTTAAAAGAATTGAGAGAGCAGTAAAATAGGACTAGATTGTG
CTAAGCAGAGCAGGACTAATGATATTAATGAATGTGATTCTATGTGACAATAAAAATTAACAGGCAGGAGCACCATCATATCCAGTATTTACAGGCAGAAGGGACGGCATGAAGTCGATG
GCAGCATCTGTCGATCTTCCATCACCATCCATCTCGTGGGAAGCGGCATTGGCATATTTCACCTCTAAAGGATTAGATATCCTTGACCTGACCACTCTCCTAG
GTAAGGAAGCTACAATC
TTTATCAATACAGTCAAGAGTAAATTATTTTCTGTTCGATATTAAAAGGGAGACAACTAAGAAAGCAGATTCGTATACTTGGAGTTTGTTTAGTTGCCAAAAACTTTTCTGAGTTTATAT
TTTCTAAATTTCATGAAAACATATATAGATAGTGAAAATTTAAAAAAAAAAAATTGAAAAGTAATAGTGAAAATATGACAGTTTCTTGTTCTTAATCCTGTTTCTTTTTCAGCAAACTAT
ACATGTTTTCTACAACTAAACAGTCTACATACATTTCTAAGTCGTTTATAAGAAAATAACAAAACAAAATAAAAAGAGAAAGAGTTGAAGAAAACACCTTGGGCATTACAGACTGCAATT
TAAATAGTCTTACAGTTACAGGAGATAGAACACACTAAAGCCTACATGAAAGAAAGAGATATTGAGAAAAGCAGGAGATAAGTAAAGTTGCAAAATTTTGCTGGGTCAAACAAAGAGGCC
TTACACACACACCAACACGCACCATTTCACCGTCCAGTTTCTAGCTTTCAATATCAGGAAAGCAGGAGGTAAGTAGAAATAAAAGGACACGACCATATGAAGAAGGCAACATTTCAATAT
GGCGTACAGGTGACTCCTATCAACCTTTGTTCATCAATGTCGCCCCTTACATTTGAGCAAGGCCTATTTTCGGGGAAAAGAAGTCTTGCAGCCAGAGAATAAATACAATAACATCTCCAA
TTTACCGAGTGTGAACGCTCCAAATCCTAAAACGACAGAATCTAGAAAGAGAAAAAAGAAGGAAGAAAAAACTTGAAGATAGTAGAGCCTTAAGGGCAATATTAAACTTCATGATACTGT
AACTTATTTATGACTGAATATCCTTATTGGTTTCAGGAGCACACTCAATGGGAAGAACACATTGCAGCCATATTGTTGATAGGCTATACAATTTCAATAATACCGGAAAGCCAGACAGAA
GCATAGCAGCAAGTTTCTTAGCCGAACTCCGGAAGCTATGTCCCAAAACCCAAAAGGGCCAAACTGACCTACTTGTATTCCTAAACCCAGAATCAGGCTCAAATTACACATTCACATCAT
CCTACTTCTCCAGAGTTCTATCAAAAAAAGTTGTCCTAGGAGTCGATCAGCAGCTACTCTTTGGTGATATCACAAAGGAGATTGTGACAGAATTGCAGGGTTTTGAAGATTTCCGGAAAT
CATTTGCATTGTCCATGAGTCGGATGGGAAACCTAAATGTTTTGACTGGAGGGAAAGGACAGATACGAAGAGATTGCCGATATATAAATCCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAAGAGATCAACCAGCAGTTACGATCCTTCCACTGTTGGCTCTTGCAGTATTAAGCTTCTTGCCGGCAGACGTGAAGGCCGCCACGTCGCTGCCGACACCTGTGAAGCTCCAA
TGGCATTACTACAAGGTCCACAATACATGTGATGATGCCGAAGCTTATATACAGTACCAAGTGAAAAGGTTTTGGCAGTCTGACAAGAGCATCACACCTAAGCTACTTCGCTTGCTCTAC
TCGGATTGTTTAGTAACC
GGCTGTGATGCATCTATTCTACTAGACGTGCCTAACTCGGAGAAGACTGCACCACAGAACATAGGCCTTGGAGGGTTTGTGGTGATCGACAAGATCAAAACT
GTTCTTGAGCAGCGGTGTCCTGGAGTAGTTTCTTGCGCTGATATTCTAAATCTTGCCACTAGAGATGCTGTTCACTTG
GCAGGAGCACCATCATATCCAGTATTTACAGGCAGAAGGGAC
GGCATGAAGTCGATGGCAGCATCTGTCGATCTTCCATCACCATCCATCTCGTGGGAAGCGGCATTGGCATATTTCACCTCTAAAGGATTAGATATCCTTGACCTGACCACTCTCCTAG
GA
GCACACTCAATGGGAAGAACACATTGCAGCCATATTGTTGATAGGCTATACAATTTCAATAATACCGGAAAGCCAGACAGAAGCATAGCAGCAAGTTTCTTAGCCGAACTCCGGAAGCTA
TGTCCCAAAACCCAAAAGGGCCAAACTGACCTACTTGTATTCCTAAACCCAGAATCAGGCTCAAATTACACATTCACATCATCCTACTTCTCCAGAGTTCTATCAAAAAAAGTTGTCCTA
GGAGTCGATCAGCAGCTACTCTTTGGTGATATCACAAAGGAGATTGTGACAGAATTGCAGGGTTTTGAAGATTTCCGGAAATCATTTGCATTGTCCATGAGTCGGATGGGAAACCTAAAT
GTTTTGACTGGAGGGAAAGGACAGATACGAAGAGATTGCCGATATATAAATCCCAACTAA

Retrieve as FASTA