Entry information : CpapPrx02 (evm.model.supercontig_1127.3)
Entry ID 8738
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapPrx02 (evm.model.supercontig_1127.3)
Name (synonym) CpapPrx02 (evm.model.supercontig_1127.3)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx02
start..stop
S start..stop
CclPrx107 413 5e-146 1..331 1..326
CsPrx58 409 2e-144 1..331 1..326
NtPrx09-1A 405 5e-143 1..331 1..324
MePrx53 404 2e-142 9..331 13..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16132..16314 183 N° 2 16456..16479 24 N° 3 16504..16710 207 N° 4 16796..16961 166
N° 5 17163..17577 415  
join(16132..16314,16456..16479,16504..16710,16796..16961,17163..17577)


exon

Literature and cross-references CpapPrx02 (evm.model.supercontig_1127.3)
DNA ref. Phytozome 11:   supercontig_1127 (16132..17577)
Protein sequence: CpapPrx02 (evm.model.supercontig_1127.3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (306)
PWM (Da):   %s   35339.8 (32516.1)  
PI (pH):   %s   5.34 (4.63) Peptide Signal:   %s   cut: 26 range:26-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRFPIRKILYLLVSLTLLVASTHAQLSSTFYDTSCPNVTSIIRGVIQQARQSNVRTGAKLIDIYVYICFIQGCDGSVLLDSSPADGIVTEKNVFPNSNSLVGFEVVDAIKTAVENVCPGVVSCADILAIASEVSVVLDGGPSWQVQLGRRDSRTTSPGDVTSSLPSSTEGLSAITSKFSALGLDTTDLVVLSGAHTFGRARCVTFQNRLFIFSGSGSPDSSIDPTFXTSLQQACPQDGSNRQSLNNLDVTTPNNFDNNYFVNLQNNRGLLQTDQELFSTNGAPTIPIVNRFAGRQSDFFDSFTKSMIKMGNISPLTGNSGEIRADCKRIX

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Short PS was missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGTTTCCAATTAGAAAAATTTTGTACCTTCTTGTTTCTTTGACATTGCTTGTAGCATCCACTCATGCTCAGCTTAGTTCTACTTTTTACGACACGAGTTGCCCTAATGTGACG
AGTATTATACGCGGAGTCATTCAACAAGCTCGACAGAGTAATGTTCGAACTGGCGCTAAACTT
GTTCGACTTCACTTTCACGATTGCTTCGTTCAAGTAATTTACATATCTCTCTTCTCT
AAGTTCCAAAATATGCTTATATATCAGAATACATGTAGATCCCTATGTATATGGCACATATTCTAGCTACTTGTCTATTGACCGATTGATATATATGTATACATATGTACATATCTCACT
AATACATGTATTTTCATACAGGGGTGTGACGGATCAGTTCTACTTGATAGTTCACCTGCAGACGGCATAGTGACCGAGAAAAATGTATTTCCAAACTCGAACTCATTAGTTGGATTCGAA
GTTGTCGATGCCATTAAAACTGCGGTAGAGAATGTTTGTCCTGGCGTCGTTTCTTGTGCTGATATTTTGGCTATTGCATCCGAAGTTTCGGTCGTTTTG
GTAATTTGATTAACTAATTAC
TATATATATAATAAAAAATTTTAATTAATTATTAATAGAGATAATTAAATTATGAGATTTGCAGGATGGAGGACCATCATGGCAAGTGCAGCTGGGAAGAAGAGACAGCAGAACAACTAG
TCCCGGAGATGTTACCAGCTCTCTTCCTTCTTCTACTGAAGGCCTTTCTGCTATCACTTCCAAATTCTCTGCTCTTGGACTTGATACAACCGATCTTGTTGTTTTATCTG
GTAANNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTAAAAAATTCAACAATATCTTCACG
TAAATTGAGAGTTATTTAAAATATTTACTGTTACGTCGTATAAAATTTTCAATAATTATGGACATTTACAGGTGCTCACACATTTGGACGGGCGAGATGTGTGACATTTCAAAATCGGCT
CTTTATTTTCAGTGGTTCGGGAAGTCCCGACTCGTCAATAGACCCGACATTCTANACTTCCTTACAGCAAGCATGCCCTCAGGATGGAAGCAATCGCCAATCACTCAACAATCTCGACGT
GACAACTCCGAACAATTTCGATAACAACTACTTCGTCAACCTTCAGAACAATCGAGGACTTCTCCAAACCGATCAAGAGCTGTTTTCGACGAATGGGGCGCCTACGATCCCGATTGTCAA
CCGGTTTGCCGGCCGCCAGAGTGATTTTTTTGATAGCTTTACTAAGTCTATGATCAAGATGGGTAATATTAGTCCTTTGACAGGAAACAGTGGGGAGATTAGGGCTGATTGCAAGAGGAT
TAATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGTTTCCAATTAGAAAAATTTTGTACCTTCTTGTTTCTTTGACATTGCTTGTAGCATCCACTCATGCTCAGCTTAGTTCTACTTTTTACGACACGAGTTGCCCTAATGTGACG
AGTATTATACGCGGAGTCATTCAACAAGCTCGACAGAGTAATGTTCGAACTGGCGCTAAACTT
ATTGATATATATGTATACATATGTTTCATACAGGGGTGTGACGGATCAGTTCTACTT
GATAGTTCACCTGCAGACGGCATAGTGACCGAGAAAAATGTATTTCCAAACTCGAACTCATTAGTTGGATTCGAAGTTGTCGATGCCATTAAAACTGCGGTAGAGAATGTTTGTCCTGGC
GTCGTTTCTTGTGCTGATATTTTGGCTATTGCATCCGAAGTTTCGGTCGTTTTG
GATGGAGGACCATCATGGCAAGTGCAGCTGGGAAGAAGAGACAGCAGAACAACTAGTCCCGGAGAT
GTTACCAGCTCTCTTCCTTCTTCTACTGAAGGCCTTTCTGCTATCACTTCCAAATTCTCTGCTCTTGGACTTGATACAACCGATCTTGTTGTTTTATCTG
GTGCTCACACATTTGGACGG
GCGAGATGTGTGACATTTCAAAATCGGCTCTTTATTTTCAGTGGTTCGGGAAGTCCCGACTCGTCAATAGACCCGACATTCTANACTTCCTTACAGCAAGCATGCCCTCAGGATGGAAGC
AATCGCCAATCACTCAACAATCTCGACGTGACAACTCCGAACAATTTCGATAACAACTACTTCGTCAACCTTCAGAACAATCGAGGACTTCTCCAAACCGATCAAGAGCTGTTTTCGACG
AATGGGGCGCCTACGATCCCGATTGTCAACCGGTTTGCCGGCCGCCAGAGTGATTTTTTTGATAGCTTTACTAAGTCTATGATCAAGATGGGTAATATTAGTCCTTTGACAGGAAACAGT
GGGGAGATTAGGGCTGATTGCAAGAGGATTAATTG

Retrieve as FASTA