Entry information : CpapPrx03 (evm.model.supercontig_119.100)
Entry ID 8739
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapPrx03 (evm.model.supercontig_119.100)
Name (synonym) CpapPrx03 (evm.model.supercontig_119.100)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx03
start..stop
S start..stop
CpapPrx05 596 0 1..347 1..347
CpapPrx06 568 0 2..347 3..348
HbPrx01 462 1e-164 10..334 7..332
MePrx57 460 5e-164 20..333 23..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 672912..673139 228 N° 2 672582..672773 192 N° 3 672292..672460 169 N° 4 671737..672191 455
complement(join(671737..672191,672292..672460,672582..672773,672912..673139))


exon

Literature and cross-references CpapPrx03 (evm.model.supercontig_119.100)
DNA ref. Phytozome 11:   supercontig_119 (673139..671737)
Protein sequence: CpapPrx03 (evm.model.supercontig_119.100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (318)
PWM (Da):   %s   37342.64 (34304.1)  
PI (pH):   %s   4.46 (4.34) Peptide Signal:   %s   cut: 30 range:30-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSTLHFYLAAATLVFATFVYGPSPAHAQLSPTFYDETCPYVTYIIGNIIYKELKTDPRIAASLNRLHFHDCFVNGCDGSLLLDNSPTIQSEKESLANNNSVRGFDVIDRMKIQLESVCPGVVSCADILTIASQISVTLSGGPLWTNLLGRRDSLIASRALADLTIPSPFDTLDQLKQRFINVGLNGDTDLVALSGAHTFGRARCVGFSHRLFNFNGTGAPDPTLNTNFLEVLREICPQGGNQSVITDLDPTTPDAFDNAYFSNLEIGKGLLQSDQELLSTPGADTADIVNEFSSNTTAFFEAFVLSMIRMGNLSVLTGTEGEIRLNCRVVNGALTLSNDNSVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCTCTACCCTTCACTTCTACCTTGCAGCTGCAACTCTAGTTTTCGCAACTTTTGTCTACGGACCTTCTCCGGCTCACGCTCAGTTGTCTCCTACGTTTTATGACGAGACGTGT
CCATACGTGACGTACATCATTGGAAATATTATTTACAAAGAATTAAAAACTGATCCTCGTATTGCTGCTAGTCTAAACAGACTTCATTTTCACGATTGCTTTGTGAAC
GTAAGATTATAT
CGAGTACCTTTTAATATATTACATATGATTTTCATCTTATTTTCAATATAATTACTTACATAATTAAAGTATCTAATATTACTTTTAAATAGAAACTGATTAATCAAGTTTGTTGATGAT
TTGAAGGGTTGTGATGGATCACTTTTGTTAGACAATAGTCCTACAATACAAAGTGAGAAGGAGTCACTGGCAAACAATAATTCAGTGAGAGGTTTTGATGTTATTGACAGAATGAAGATC
CAATTGGAGAGTGTTTGTCCCGGAGTCGTTTCCTGTGCCGATATACTCACTATAGCATCTCAAATATCTGTTACTTTG
GTGCGATTTATATTTATTTTTGTCAATTAATTATTCACTGTG
AAAAATAGATATAACAATTCTTATAAGCTTGACGAGATATTTGATAAGAAAATATAAATATTCATTCTTTCACTTCCAGTCAGGAGGTCCCTTATGGACGAATCTATTGGGAAGAAGAGA
TAGTTTGATTGCCAGTCGAGCTCTTGCCGATTTGACCATTCCTTCACCATTTGATACTCTTGATCAGCTCAAACAAAGATTTATAAATGTTGGCCTTAATGGTGATACTGATTTAGTTGC
ACTCTCTG
GTAATATATTTGTTTTATTAGGGTGGTTTTGTCTATTTAAGATCTTATTAGGGTCCTTAGTATTTAAAATTATTAATTTTTTTTTTTATTTTTCTCCTAGGTGCTCACACAT
TTGGAAGAGCTCGTTGTGTAGGATTCTCTCACCGATTATTCAATTTCAATGGCACTGGTGCTCCAGATCCAACTTTAAATACTAACTTCCTAGAAGTGCTTCGAGAAATATGTCCTCAAG
GTGGAAACCAAAGTGTCATCACTGATCTTGATCCAACCACACCTGATGCTTTCGACAACGCCTATTTCTCTAACCTTGAGATTGGAAAAGGTTTGTTGCAAAGTGATCAAGAACTGCTTT
CAACTCCTGGTGCTGATACTGCCGATATCGTCAACGAATTTAGCAGTAACACTACTGCCTTCTTCGAAGCTTTCGTATTATCTATGATTAGAATGGGAAATCTAAGTGTGTTAACAGGCA
CCGAAGGAGAAATCAGATTGAATTGTAGAGTGGTTAATGGAGCTCTGACTTTATCAAATGACAATTCAGTAAGTTCAATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCTCTACCCTTCACTTCTACCTTGCAGCTGCAACTCTAGTTTTCGCAACTTTTGTCTACGGACCTTCTCCGGCTCACGCTCAGTTGTCTCCTACGTTTTATGACGAGACGTGT
CCATACGTGACGTACATCATTGGAAATATTATTTACAAAGAATTAAAAACTGATCCTCGTATTGCTGCTAGTCTAAACAGACTTCATTTTCACGATTGCTTTGTGAAC
GGTTGTGATGGA
TCACTTTTGTTAGACAATAGTCCTACAATACAAAGTGAGAAGGAGTCACTGGCAAACAATAATTCAGTGAGAGGTTTTGATGTTATTGACAGAATGAAGATCCAATTGGAGAGTGTTTGT
CCCGGAGTCGTTTCCTGTGCCGATATACTCACTATAGCATCTCAAATATCTGTTACTTTG
TCAGGAGGTCCCTTATGGACGAATCTATTGGGAAGAAGAGATAGTTTGATTGCCAGTCGA
GCTCTTGCCGATTTGACCATTCCTTCACCATTTGATACTCTTGATCAGCTCAAACAAAGATTTATAAATGTTGGCCTTAATGGTGATACTGATTTAGTTGCACTCTCTG
GTGCTCACACA
TTTGGAAGAGCTCGTTGTGTAGGATTCTCTCACCGATTATTCAATTTCAATGGCACTGGTGCTCCAGATCCAACTTTAAATACTAACTTCCTAGAAGTGCTTCGAGAAATATGTCCTCAA
GGTGGAAACCAAAGTGTCATCACTGATCTTGATCCAACCACACCTGATGCTTTCGACAACGCCTATTTCTCTAACCTTGAGATTGGAAAAGGTTTGTTGCAAAGTGATCAAGAACTGCTT
TCAACTCCTGGTGCTGATACTGCCGATATCGTCAACGAATTTAGCAGTAACACTACTGCCTTCTTCGAAGCTTTCGTATTATCTATGATTAGAATGGGAAATCTAAGTGTGTTAACAGGC
ACCGAAGGAGAAATCAGATTGAATTGTAGAGTGGTTAATGGAGCTCTGACTTTATCAAATGACAATTCAGTAAGTTCAATATGA

Retrieve as FASTA