Entry information : CpapPrx06 (CpPOD2 / evm.model.supercontig_119.99)
Entry ID 8742
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx06 (CpPOD2 / evm.model.supercontig_119.99)
Name (synonym) CpapPrx06 (CpPOD2 / evm.model.supercontig_119.99)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx06
start..stop
S start..stop
CpapPrx03 585 0 3..348 2..347
CpapPrx05 565 0 3..348 2..347
CclPrx05 457 1e-162 5..348 2..350
CclPrx68 456 4e-162 10..347 6..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 669425..669655 231 N° 2 668424..668615 192 N° 3 668149..668317 169 N° 4 667591..668045 455
complement(join(667591..668045,668149..668317,668424..668615,669425..669655))


exon

Literature and cross-references CpapPrx06 (CpPOD2 / evm.model.supercontig_119.99)
DNA ref. Phytozome 11:   supercontig_119 (669655..667591)
Protein sequence: CpapPrx06 (CpPOD2 / evm.model.supercontig_119.99)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (318)
PWM (Da):   %s   37591.23 (34330.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.75 (7.70) Peptide Signal:   %s   cut: 31 range:31-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSSTIHFYLAAATLFFAALFHGPSPSHAQLSPTFYDRTCPQVTKIIRDVIYKELRTDIRIAASLNRLHFHDCFVNGCDGSLLLDNSPTIDSEKQSLGNNNSVRGFDVVDRMKSQLEKVCPGVVSCADILTIASQISVTLSGGPSWTNLLGRRDGLTASRALADENLPSPFDSLELLKQRFTKVGLNGDVDLVALSGAHTFGKARCLGFAHRLFNFSGQGAPDPTLNKSFLKKLQKICPQGGNGSVITDLDVTTPNAFDNAYFTNLKIGKGLLETDQILLSAPGADTADIVKKFSKNTFAFFEAFVLSMIRMGNLSVLTGNQGEIRLNCRVVNGPSTLSDDNLVSSI*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTTCTTCCACCATTCACTTCTACCTTGCAGCTGCAACTCTATTTTTCGCAGCTCTTTTCCACGGACCTTCTCCGTCTCACGCACAATTATCTCCTACGTTTTACGACAGGACG
TGTCCGCAAGTGACAAAGATCATCAGAGATGTTATCTATAAAGAATTGAGGACGGATATTCGCATTGCTGCGAGTCTCAACAGGCTTCATTTCCACGATTGCTTTGTCAAT
GTAAGATTC
GACCCAGTACCCTTTAACATAGTTTATGTGATTGTTTATCTTATATTTCACTGTATATTTTGATACATTATATATATATATAAATATATATGTCTATTTAAATGTACATCATGGTGTACC
CTTTAATATTCACTATATATTTTGAGATGTATCTCTCTTTACATGTATATCGTAGTGGGTATTCAGGGATTAGTGAAACAATATATTACGTATGTTATTTATTTTTGTGATGATGAAGAT
ATTTAAAGATTTTGTACAGAAAGATTATTAAGAAACTCAAATCTTTTCTGGTTCTGTTTTCTTTTCTTTCCTTCACTTGTTTTTCTTGCTAAAAGAGGAATAAAAAGGGTTGGGTTAAGC
AGACAAGCCAAGTGTTTTTCTTGGTTTTCTCTGGAAACTATTGATTAGTAGATTCAGTGAACCTTATCGTTAGTTGACTGGTGCAATTACGGTAATATATATATATATTTATATATATCA
CACCACAAACACGTACATACTTACATAGTACATATATATATATATATATATATATACAGACACACAAACAAACACACATGGGTTGAGAAAAGGACAGAAAAAATTTATGCATAAAGTAAA
TGAACTGAAGATGACAGGCTACCAAAACATGGAGGTGGGACGAGAAAATCAAACCAAGATGACTAATTTTCATGTAATTACTCGATGACTAAATGATCCAGCACTGCTAGTCCTTAATTT
TCCCTTTCTTTTGCTAATAATTTACTAACTAATCTCATGTAAAACTTAATTACTCAATCAAGTTCGTCGACAATCTGTAGGGTTGTGATGGATCTCTTTTGTTGGACAACAGTCCTACAA
TAGATAGCGAGAAGCAATCGCTGGGAAATAATAACTCGGTGAGGGGTTTCGACGTTGTTGACAGAATGAAGAGCCAATTGGAGAAAGTTTGTCCCGGAGTCGTTTCTTGTGCTGATATAC
TCACGATCGCATCTCAAATATCTGTCACTTTG
GTACAGTACATAAATTTTTCTTGTTAAGAGAATATGTAAATGTTCATTCTCTTGTTGGCTTATAAACTGTGGTGTAAAAAAAAAAAAA
AAAATTTTGCATTTTCAGTCGGGAGGTCCCTCGTGGACAAATCTATTGGGAAGGAGAGACGGCTTGACTGCCAGCCGAGCTCTTGCCGACGAGAACCTTCCTTCACCATTTGATTCTCTT
GAGTTGCTCAAACAAAGATTTACAAAAGTTGGACTCAATGGTGATGTTGACTTAGTTGCACTATCCG
GTAATATACATGTTTTTTCGTTCTTATATTTGACCATTTAGGTTTCTAATTTC
AGAGTATTTTTTTATCACTTTAGCACGTAACTCGTTTACAATTCTCTCAGGCGCCCACACATTTGGAAAAGCACGGTGCTTAGGATTCGCCCACCGATTGTTCAATTTCAGCGGCCAAGG
TGCTCCGGATCCAACCCTCAACAAAAGCTTTCTGAAAAAGCTTCAGAAAATATGCCCTCAAGGCGGCAACGGAAGTGTCATCACTGATCTTGACGTAACAACACCTAATGCTTTTGATAA
TGCCTACTTCACTAACCTCAAGATCGGAAAGGGTTTGCTTGAAACTGATCAAATACTTCTCTCGGCTCCTGGAGCCGATACTGCTGATATCGTCAAAAAATTTAGCAAGAACACTTTTGC
CTTCTTCGAAGCTTTCGTGTTATCTATGATAAGAATGGGCAATCTTAGCGTTCTAACAGGGAATCAAGGAGAGATTAGATTGAACTGTAGGGTAGTCAACGGACCTTCAACTTTATCAGA
CGACAATTTGGTGAGCTCAATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTTCTTCCACCATTCACTTCTACCTTGCAGCTGCAACTCTATTTTTCGCAGCTCTTTTCCACGGACCTTCTCCGTCTCACGCACAATTATCTCCTACGTTTTACGACAGGACG
TGTCCGCAAGTGACAAAGATCATCAGAGATGTTATCTATAAAGAATTGAGGACGGATATTCGCATTGCTGCGAGTCTCAACAGGCTTCATTTCCACGATTGCTTTGTCAAT
GGTTGTGAT
GGATCTCTTTTGTTGGACAACAGTCCTACAATAGATAGCGAGAAGCAATCGCTGGGAAATAATAACTCGGTGAGGGGTTTCGACGTTGTTGACAGAATGAAGAGCCAATTGGAGAAAGTT
TGTCCCGGAGTCGTTTCTTGTGCTGATATACTCACGATCGCATCTCAAATATCTGTCACTTTG
TCGGGAGGTCCCTCGTGGACAAATCTATTGGGAAGGAGAGACGGCTTGACTGCCAGC
CGAGCTCTTGCCGACGAGAACCTTCCTTCACCATTTGATTCTCTTGAGTTGCTCAAACAAAGATTTACAAAAGTTGGACTCAATGGTGATGTTGACTTAGTTGCACTATCCG
GCGCCCAC
ACATTTGGAAAAGCACGGTGCTTAGGATTCGCCCACCGATTGTTCAATTTCAGCGGCCAAGGTGCTCCGGATCCAACCCTCAACAAAAGCTTTCTGAAAAAGCTTCAGAAAATATGCCCT
CAAGGCGGCAACGGAAGTGTCATCACTGATCTTGACGTAACAACACCTAATGCTTTTGATAATGCCTACTTCACTAACCTCAAGATCGGAAAGGGTTTGCTTGAAACTGATCAAATACTT
CTCTCGGCTCCTGGAGCCGATACTGCTGATATCGTCAAAAAATTTAGCAAGAACACTTTTGCCTTCTTCGAAGCTTTCGTGTTATCTATGATAAGAATGGGCAATCTTAGCGTTCTAACA
GGGAATCAAGGAGAGATTAGATTGAACTGTAGGGTAGTCAACGGACCTTCAACTTTATCAGACGACAATTTGGTGAGCTCAATATGA

Retrieve as FASTA