Entry information : CpapPrx09 (CpPOD4 / evm.model.supercontig_140.2)
Entry ID 8744
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx09 (CpPOD4 / evm.model.supercontig_140.2)
Name (synonym) CpapPrx09 (CpPOD4 / evm.model.supercontig_140.2)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx09
start..stop
S start..stop
VvPrx89 529 0 1..344 1..352
GmPrx296 521 0 19..344 5..333
ThasPrx40 520 0 1..344 1..346
BrPrx09-1Aa_other 516 0 20..344 12..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15395..15655 261 N° 2 15106..15297 192 N° 3 14859..15024 166 N° 4 14339..14754 416
complement(join(14339..14754,14859..15024,15106..15297,15395..15655))


exon

Literature and cross-references CpapPrx09 (CpPOD4 / evm.model.supercontig_140.2)
DNA ref. Phytozome 11:   supercontig_140 (15655..14339)
Protein sequence: CpapPrx09 (CpPOD4 / evm.model.supercontig_140.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345
PWM (Da):   %s   37904.35  
PI (pH):   %s   7.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFFNFIIPHIILVITGGFLSATFSVEAHPGWWSNNGYPFGLSPQYYQFSCPQVNDVVMSVLEKAILKEPRIAASLLRLHFHDCFVQGCDASVLLDDSAVIVSEKNSLPNKNSIRGFELIDEIKSKLEEACPQTVSCADILALAARGSTILSGGPSWKLPLGRRDSKTASLTDSNNNIPAPNSTIQNLITLFKRQGLSETDLVALSGGHTIGVARCLTFKQRLYNQNGNNQPDETLEKTYYYGLKSVCPKSGGDNKISPLDFASPAKFDNTYFKLIMWGKGLLSSDQVLFTGDHAVKTTQLVKAYAEDEALFFQQFAKSMIKMGNINPLTGLIGELRENCRRLN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTCTTCAACTTTATAATTCCCCATATCATATTAGTAATTACCGGCGGTTTCCTCTCAGCCACATTTTCTGTGGAGGCACATCCTGGCTGGTGGAGTAATAATGGATATCCATTT
GGCCTGTCTCCACAATATTATCAATTCTCATGCCCTCAAGTTAATGATGTTGTTATGTCTGTGTTGGAAAAGGCAATTCTAAAGGAGCCAAGAATAGCAGCTTCCTTGTTGAGGCTTCAT
TTTCATGATTGTTTTGTGCAG
GTTAACCACTTCATTTGCTTGCCATGCATGCATTACTTTTTATTGTTCAATCCTCTTTACTTCACTAATTAGAAAGTACATAAATTAAATATTACAGGG
TTGCGATGCATCAGTGTTATTGGACGATAGTGCAGTGATTGTTAGCGAAAAGAACTCGTTACCAAACAAGAATTCCATTAGAGGGTTTGAATTAATAGATGAAATCAAGAGTAAGTTGGA
AGAAGCATGTCCTCAAACTGTCTCCTGTGCTGACATTTTGGCTTTAGCTGCTCGAGGCTCCACTATTCTG
GTAATTAGATTTGTCGAACCAGTGGGAATGAGCTTTTAAAATTTTATGGA
GGTTTTTAACATTGGTTTAGAAAATTAACAGAGCGGTGGACCATCTTGGAAGCTCCCATTAGGAAGGAGAGACTCAAAGACAGCAAGCCTTACTGATTCAAACAATAATATTCCTGCACC
AAATTCCACTATCCAAAATCTCATAACATTGTTTAAACGACAGGGTTTATCTGAAACTGATCTTGTTGCACTCTCGG
GTACTTTGTATATATTTATATATTTAAATATATTGATTTCTAG
CTATGATTGACATTGTTCAACTCATATGCATGAACTAATTATATATAATATATCAATACAGGAGGACATACAATTGGAGTGGCAAGATGTTTGACATTCAAGCAAAGATTATACAATCAA
AATGGAAACAACCAGCCGGATGAGACACTAGAAAAGACCTACTACTACGGGTTAAAAAGTGTGTGCCCAAAATCTGGTGGTGATAACAAAATCTCTCCTTTAGATTTTGCCTCCCCAGCA
AAATTTGACAACACATATTTTAAGCTCATAATGTGGGGGAAAGGACTTCTAAGTTCAGATCAAGTTCTATTCACAGGGGATCATGCCGTCAAAACTACACAGCTAGTTAAGGCATATGCA
GAAGATGAAGCTCTCTTCTTTCAACAATTCGCTAAATCAATGATTAAAATGGGTAATATTAATCCTCTTACTGGGTTAATCGGAGAATTAAGGGAGAATTGTCGTCGACTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTCTTCAACTTTATAATTCCCCATATCATATTAGTAATTACCGGCGGTTTCCTCTCAGCCACATTTTCTGTGGAGGCACATCCTGGCTGGTGGAGTAATAATGGATATCCATTT
GGCCTGTCTCCACAATATTATCAATTCTCATGCCCTCAAGTTAATGATGTTGTTATGTCTGTGTTGGAAAAGGCAATTCTAAAGGAGCCAAGAATAGCAGCTTCCTTGTTGAGGCTTCAT
TTTCATGATTGTTTTGTGCAG
GGTTGCGATGCATCAGTGTTATTGGACGATAGTGCAGTGATTGTTAGCGAAAAGAACTCGTTACCAAACAAGAATTCCATTAGAGGGTTTGAATTAATA
GATGAAATCAAGAGTAAGTTGGAAGAAGCATGTCCTCAAACTGTCTCCTGTGCTGACATTTTGGCTTTAGCTGCTCGAGGCTCCACTATTCTG
AGCGGTGGACCATCTTGGAAGCTCCCA
TTAGGAAGGAGAGACTCAAAGACAGCAAGCCTTACTGATTCAAACAATAATATTCCTGCACCAAATTCCACTATCCAAAATCTCATAACATTGTTTAAACGACAGGGTTTATCTGAAACT
GATCTTGTTGCACTCTCGG
GAGGACATACAATTGGAGTGGCAAGATGTTTGACATTCAAGCAAAGATTATACAATCAAAATGGAAACAACCAGCCGGATGAGACACTAGAAAAGACCTAC
TACTACGGGTTAAAAAGTGTGTGCCCAAAATCTGGTGGTGATAACAAAATCTCTCCTTTAGATTTTGCCTCCCCAGCAAAATTTGACAACACATATTTTAAGCTCATAATGTGGGGGAAA
GGACTTCTAAGTTCAGATCAAGTTCTATTCACAGGGGATCATGCCGTCAAAACTACACAGCTAGTTAAGGCATATGCAGAAGATGAAGCTCTCTTCTTTCAACAATTCGCTAAATCAATG
ATTAAAATGGGTAATATTAATCCTCTTACTGGGTTAATCGGAGAATTAAGGGAGAATTGTCGTCGACTTAATTAG

Retrieve as FASTA