Entry information : CpapPrx13 (evm.model.supercontig_16.92)
Entry ID 8747
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapPrx13 (evm.model.supercontig_16.92)
Name (synonym) CpapPrx13 (evm.model.supercontig_16.92)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx13
start..stop
S start..stop
AlyPrx24 386 2e-135 1..296 34..339
BrPrx24-1Aa_other 384 2e-134 1..296 47..353
CagraPrx53 382 1e-133 1..296 36..341
BstrPrx84 381 2e-133 1..296 36..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1489405..1489567 163 N° 2 1488783..1488974 192 N° 3 1488511..1488676 166 N° 4 1487895..1488288 394
complement(join(1487895..1488288,1488511..1488676,1488783..1488974,1489405..1489 567))


exon

Literature and cross-references CpapPrx13 (evm.model.supercontig_16.92)
DNA ref. Phytozome 11:   supercontig_16 (1489567..1487895)
Protein sequence: CpapPrx13 (evm.model.supercontig_16.92)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   306
PWM (Da):   %s   33075.74  
PI (pH):   %s   7.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GHGKGELRMMFYHKTCPQVEEVVKXDITWSKVENNPSMAAKLLRLQYHDCFVRVCDASILLDSTSGNTSEKDARPNLSLSGYEVIDDIKAKLEQECPKTVSCADIVALAARDAVSFQVKRSLWNVVTGRQDGRVSLASEAVRDLPSAGANFTTLQQQFAANGLDVTDLVALSGMHTIGGARCAXFARRLFNFSGKDDIDPSLNSDYANFLIRKCSDRTALVEMDPGSSLLFDTDYFKAVKQNKGLFMSDAALLTNPRSAFIVKLFQNPLLFFSQFGASMQKMGQIKGDDSDGVRLGGVIALLIN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Very short 5' end is missing and frame shift before FHDC). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTCATGGCAAGGGCGAGCTAAGGATGATGTTCTATCACAAGACTTGTCCTCAGGTTGAGGAGGTTGTGAAGGNNGATATTACATGGAGTAAAGTTGAGAATAATCCAAGCATGGCAGCT
AAGCTACTGAGGCTGCAATACCATGACTGTTTTGTTAGGGTAT
GTTCCCTTTTAAATCCTTCTAATCTCTTCAAATTATATATGTAAGAATATATATATAAGTATATTTTGTTGATCCAC
AAGTGTTAATCCAGTTGGTAAAGAATGTTCTACATATTTGATCAATTTATATTAATGTATGGAAGTATTGATCCTAGCAGCACCATCTGATGGGTCCATGGGAGTACATTCTTAATTAAA
ACTACCAAGAGAAGAACATAGTTTTGGCATGTAGAAGCTGGTTCAAAAGTATTCATACTGCTAGAACAGTACACACACACACGAAAGATACAATATTATTTTGTTAGGCTATGTTTCGCT
TGTTTTAACATCAAAAGTTTTTTAGCTTTCTAATCATGATTACTGACTGTCTTATGTGCGTTAATTAGCCAAAAAAATCAATTGTTTCACAGTATACGCGTTCTTGCAGGGATGTGATGC
ATCCATATTATTGGATTCAACTAGCGGTAACACATCTGAGAAAGATGCAAGACCAAATCTCTCGTTATCCGGTTACGAGGTCATTGATGACATAAAAGCTAAACTAGAACAGGAATGTCC
CAAAACCGTGTCGTGTGCTGATATCGTTGCCTTGGCAGCTCGTGATGCTGTTTCATTTCAAGTAA
GATACGGCCAATTATTAACTTTTGATGCTTATGGCAGTGGCACTGGTCTCTAACA
TGCATGAATATGTGAACTTATATATGTGTGCGTATGTATATATGCAGTTTAAAAGATCGCTATGGAATGTTGTGACTGGGAGGCAAGATGGAAGAGTTTCACTTGCCTCAGAGGCTGTAA
GAGATTTACCATCTGCAGGAGCAAACTTCACCACTCTCCAACAGCAATTTGCAGCTAATGGCCTTGATGTCACAGACCTTGTTGCTTTATCAGGTAT
TCTTTATTTTATTATATTATGAT
TTTTTAATGTTAATTTAGACCTAATTTCGATTACTCTTTAAAAAAATATATTGTTTTTAAATAAAAATATATAAATAAGATAATACATAATCATAATATAACTTTTCAATAAGAATTCAG
GTAATGTATAATCTAATTCAAACCTATAAATTCATATGAAGAAATCGTGATGAGATATAAATTTAATTTGTATAGGAGCGCATACAATTGGAGGTGCACGTTGTGCNNNNTTTGCGAGGA
GACTATTCAATTTCAGTGGAAAAGATGATATTGATCCTTCATTGAATTCAGACTATGCAAATTTCTTGATAAGAAAATGTTCTGATCGGACGGCGTTGGTGGAAATGGATCCCGGAAGTT
CGCTATTGTTTGATACCGATTACTTCAAGGCAGTTAAGCAGAACAAAGGATTGTTTATGTCAGATGCAGCTCTCCTCACTAATCCTCGTTCGGCTTTCATCGTTAAGCTTTTCCAAAATC
CTCTACTTTTCTTTTCCCAGTTTGGAGCTTCAATGCAGAAAATGGGTCAAATTAAAGGAGATGATTCTGATGGGGTGAGATTAGGAGGAGTTATCGCTTTGTTAATTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTCATGGCAAGGGCGAGCTAAGGATGATGTTCTATCACAAGACTTGTCCTCAGGTTGAGGAGGTTGTGAAGGNNGATATTACATGGAGTAAAGTTGAGAATAATCCAAGCATGGCAGCT
AAGCTACTGAGGCTGCAATACCATGACTGTTTTGTTAGGGTAT
GTGATGCATCCATATTATTGGATTCAACTAGCGGTAACACATCTGAGAAAGATGCAAGACCAAATCTCTCGTTATCC
GGTTACGAGGTCATTGATGACATAAAAGCTAAACTAGAACAGGAATGTCCCAAAACCGTGTCGTGTGCTGATATCGTTGCCTTGGCAGCTCGTGATGCTGTTTCATTTCAAGTAA
AAAGA
TCGCTATGGAATGTTGTGACTGGGAGGCAAGATGGAAGAGTTTCACTTGCCTCAGAGGCTGTAAGAGATTTACCATCTGCAGGAGCAAACTTCACCACTCTCCAACAGCAATTTGCAGCT
AATGGCCTTGATGTCACAGACCTTGTTGCTTTATCAGGTAT
GCATACAATTGGAGGTGCACGTTGTGCNNNNTTTGCGAGGAGACTATTCAATTTCAGTGGAAAAGATGATATTGATCCT
TCATTGAATTCAGACTATGCAAATTTCTTGATAAGAAAATGTTCTGATCGGACGGCGTTGGTGGAAATGGATCCCGGAAGTTCGCTATTGTTTGATACCGATTACTTCAAGGCAGTTAAG
CAGAACAAAGGATTGTTTATGTCAGATGCAGCTCTCCTCACTAATCCTCGTTCGGCTTTCATCGTTAAGCTTTTCCAAAATCCTCTACTTTTCTTTTCCCAGTTTGGAGCTTCAATGCAG
AAAATGGGTCAAATTAAAGGAGATGATTCTGATGGGGTGAGATTAGGAGGAGTTATCGCTTTGTTAATTAATTAG

Retrieve as FASTA