Entry information : CpapPrx14 (CpPOD7 / evm.model.supercontig_171.8)
Entry ID 8748
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx14 (CpPOD7 / evm.model.supercontig_171.8)
Name (synonym) CpapPrx14 (CpPOD7 / evm.model.supercontig_171.8)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx14
start..stop
S start..stop
VvPrx65 520 0 2..323 1..323
MePrx64 511 0 4..323 2..324
CclPrx43 507 0 9..322 9..324
CsPrx20 501 0 9..322 11..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58573..58782 210 N° 2 58249..58440 192 N° 3 57530..58099 570  
complement(join(57530..58099,58249..58440,58573..58782))


exon

Literature and cross-references CpapPrx14 (CpPOD7 / evm.model.supercontig_171.8)
DNA ref. Phytozome 11:   supercontig_171 (58782..57530)
Protein sequence: CpapPrx14 (CpPOD7 / evm.model.supercontig_171.8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (300)
PWM (Da):   %s   34882.49 (32217.0)  
PI (pH):   %s   5.01 (4.74) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVEKWKRGLILIVVCVILQKGDGQLAENFYGVTCSNVESIVKQAVLNKFSQTFTTVPATLRLFFHDCFIEGCDASILISSRNGDAEKDAPDNLSLAGDGFDTIIKAKQAVEAQCPGVVSCADILALAAREVVGLAGGPSYSVELGRRDGLISQASRVRGALPEPDFNLIQLTEIFARNNLSQLDMIALSGAHTVGFSHCSRFANRLYSFSASNPVDPSLNPDYMKQLMAACPRNVDPNIAIDMDPETPRTFDNVYYKNLVAGKGMFTSDQVLFTDSSTQPIVKDFANGDFSGAFVTAMTKLGRIGVKTGTEGEIRKDCTAFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGAGAAATGGAAAAGAGGGTTGATTTTGATAGTTGTTTGTGTGATTTTGCAGAAGGGAGATGGACAATTAGCAGAAAATTTCTATGGTGTCACTTGTTCAAACGTGGAATCCATT
GTTAAGCAAGCTGTGCTTAACAAGTTTAGTCAGACTTTCACCACTGTCCCAGCTACTCTGCGCCTGTTTTTCCATGACTGCTTCATTGAG
GTATACATACACGCATTCAAATACATGTAT
ATACACATTTTTATAAAATTTTACATTGATGGTTTCTTTTGTTCTTTTTGGCTTCTGGGTGTTTTTTCTTTTTAATCGTCAAATTTGTTGATCTTTTTGAAGGGATGTGATGCGTCAATT
TTGATTTCATCGCGAAACGGGGATGCAGAGAAGGATGCTCCGGACAATCTTTCACTTGCTGGAGATGGATTTGATACGATAATAAAGGCGAAGCAAGCAGTCGAAGCACAATGTCCTGGT
GTTGTCTCATGTGCTGATATCTTAGCACTTGCTGCTAGAGAAGTTGTTGGCCTA
GTAAGTCACATTTTAAATCATGATCTCGAAATTGAATAATCAAGCATTTAGCTCGCATGAGAACGT
GGAAATGGCCTGATCATTACTCTTTTGTGAATTAAATTTTCAATTCTTTCTATGTTTATGCATATATGGATCAAAATTTTCAGGCAGGAGGTCCTTCATATAGCGTAGAGCTAGGACGTC
GTGATGGTTTAATATCTCAAGCGTCAAGGGTACGAGGAGCTTTGCCAGAGCCTGACTTCAATCTTATACAGCTTACTGAAATTTTTGCAAGGAATAACCTGAGCCAGCTTGACATGATTG
CGTTATCAGGAGCTCATACTGTTGGATTCTCTCATTGTAGTCGCTTTGCAAATCGACTCTACTCTTTCTCTGCATCAAATCCTGTTGATCCTTCTCTGAATCCGGACTATATGAAGCAAC
TGATGGCTGCCTGCCCTCGGAATGTAGACCCAAATATAGCCATTGACATGGACCCTGAAACTCCAAGAACTTTTGACAATGTATATTACAAGAATCTGGTTGCAGGGAAGGGCATGTTTA
CTTCTGATCAGGTGCTGTTCACTGATTCGTCAACACAGCCAATTGTCAAGGATTTCGCCAACGGTGATTTTAGCGGAGCTTTTGTCACTGCAATGACAAAGCTGGGCAGGATTGGAGTGA
AGACTGGTACTGAAGGGGAAATAAGAAAAGACTGCACTGCTTTTAACTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGAGAAATGGAAAAGAGGGTTGATTTTGATAGTTGTTTGTGTGATTTTGCAGAAGGGAGATGGACAATTAGCAGAAAATTTCTATGGTGTCACTTGTTCAAACGTGGAATCCATT
GTTAAGCAAGCTGTGCTTAACAAGTTTAGTCAGACTTTCACCACTGTCCCAGCTACTCTGCGCCTGTTTTTCCATGACTGCTTCATTGAG
GGATGTGATGCGTCAATTTTGATTTCATCG
CGAAACGGGGATGCAGAGAAGGATGCTCCGGACAATCTTTCACTTGCTGGAGATGGATTTGATACGATAATAAAGGCGAAGCAAGCAGTCGAAGCACAATGTCCTGGTGTTGTCTCATGT
GCTGATATCTTAGCACTTGCTGCTAGAGAAGTTGTTGGCCTA
GCAGGAGGTCCTTCATATAGCGTAGAGCTAGGACGTCGTGATGGTTTAATATCTCAAGCGTCAAGGGTACGAGGAGCT
TTGCCAGAGCCTGACTTCAATCTTATACAGCTTACTGAAATTTTTGCAAGGAATAACCTGAGCCAGCTTGACATGATTGCGTTATCAGGAGCTCATACTGTTGGATTCTCTCATTGTAGT
CGCTTTGCAAATCGACTCTACTCTTTCTCTGCATCAAATCCTGTTGATCCTTCTCTGAATCCGGACTATATGAAGCAACTGATGGCTGCCTGCCCTCGGAATGTAGACCCAAATATAGCC
ATTGACATGGACCCTGAAACTCCAAGAACTTTTGACAATGTATATTACAAGAATCTGGTTGCAGGGAAGGGCATGTTTACTTCTGATCAGGTGCTGTTCACTGATTCGTCAACACAGCCA
ATTGTCAAGGATTTCGCCAACGGTGATTTTAGCGGAGCTTTTGTCACTGCAATGACAAAGCTGGGCAGGATTGGAGTGAAGACTGGTACTGAAGGGGAAATAAGAAAAGACTGCACTGCT
TTTAACTCATGA

Retrieve as FASTA