Entry information : CpapPrx15 (CpPOD8 / evm.model.supercontig_173.15)
Entry ID 8749
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx15 (CpPOD8 / evm.model.supercontig_173.15)
Name (synonym) CpapPrx15 (CpPOD8 / evm.model.supercontig_173.15)
Class Class III peroxidase     [Orthogroup: Prx108]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx15
start..stop
S start..stop
VvPrx49 370 2e-129 11..314 12..315
VvPrx88 363 9e-127 11..314 12..315
VvPrx21 363 1e-126 11..314 12..315
StPrx25 362 2e-126 1..314 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 160131..160334 204 N° 2 160447..160638 192 N° 3 160751..160916 166 N° 4 160994..161379 386
join(160131..160334,160447..160638,160751..160916,160994..161379)


exon

Literature and cross-references CpapPrx15 (CpPOD8 / evm.model.supercontig_173.15)
DNA ref. Phytozome 11:   supercontig_173 (160131..161379)
Protein sequence: CpapPrx15 (CpPOD8 / evm.model.supercontig_173.15)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   34089.29 (31904.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.35 (5.35) Peptide Signal:   %s   cut: 22 range:22-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFSGIVGIVFSCIFGVAVAQLSSDFYATSCPKALSIINDTVVKAVQKELRMGASLLRLQFHDCFVNGCDGSVLLDQTSNITGEKDALQNQNSLRGFEVVDDIKAELEHACPGVVSCADILTVAARDSVVALGGPSWAVELGRRDSLNASKEAAEKDLPVFSHDLETLTALFARKGFNASELVILSGGHTIGSAACVTYRVHIYNDTYIDPVFRQSLQSICKFRGPIDPLAALDNTADVFDNEFFKDLLHLKGVLRTDQVLYHNATTDELVKTYSNNSALFFSDFGAAMVKLGKLDVLLGSQGQIRTNCRKVNE*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTTCTCCGGTATCGTAGGTATCGTGTTCTCGTGTATTTTCGGTGTCGCTGTCGCTCAATTATCTTCTGATTTTTACGCAACTTCATGCCCCAAAGCTCTCTCCATTATCAAT
GACACAGTTGTTAAGGCAGTCCAGAAAGAACTCCGCATGGGAGCTTCTTTGCTCCGACTTCAATTCCATGATTGCTTCGTTAAT
GTAAATATTCATTCTTCTTAAACTCAGCACTTGCAT
TCTTGTTTGCTAAAATTAAAAGGGTTTTTTTTTTTTTTTTATATGAGAAGATTATGGTTCTTGAAATTTTTAACAGGGTTGTGACGGTTCTGTCTTACTGGATCAAACATCCAACATAAC
GGGAGAGAAAGATGCGCTTCAGAATCAGAATTCTTTGAGGGGATTCGAAGTGGTTGACGACATAAAAGCGGAGCTCGAACATGCTTGTCCTGGAGTTGTCTCCTGTGCTGACATTTTAAC
CGTTGCAGCTCGTGATTCTGTTGTCGCC
GTATGTATTTATGCCAATAATTTAGAAACTTCAGATGGTTTCGACGAATTTTCTTCCATTTGTGTGCATGCTTTATGTCTTCCGATGACTAC
ATACATAAATATTTTCACAGTTGGGCGGTCCTTCTTGGGCTGTGGAGCTAGGAAGAAGGGATTCTTTGAATGCAAGTAAAGAAGCAGCCGAGAAAGACCTCCCTGTATTCTCCCATGATC
TCGAGACTCTCACCGCACTCTTTGCAAGAAAGGGTTTCAATGCCTCCGAACTAGTGATTCTATCAG
GTGCGTTAAAAGTCAGTCAGTTAAGAAAATCATTCTAGTAAAATCAATGCTTGT
AATTCTCTTTGTCATTCATTTAGGAGGTCACACCATTGGGAGTGCAGCATGTGTAACTTATAGAGTCCACATATACAACGACACATACATAGATCCCGTTTTCCGACAGTCTCTGCAATC
GATTTGCAAATTTAGAGGTCCGATTGATCCTTTGGCGGCTCTTGATAACACGGCCGACGTCTTCGACAACGAGTTCTTCAAAGATCTATTGCACTTGAAGGGTGTTCTTAGGACAGATCA
AGTGCTTTACCATAATGCTACCACAGACGAGCTGGTGAAGACATATAGTAACAACTCTGCTTTGTTTTTCTCTGATTTCGGAGCTGCAATGGTTAAGTTGGGAAAGCTCGACGTGCTTCT
TGGATCGCAAGGACAAATCCGAACTAATTGCAGGAAAGTTAACGAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTTCTCCGGTATCGTAGGTATCGTGTTCTCGTGTATTTTCGGTGTCGCTGTCGCTCAATTATCTTCTGATTTTTACGCAACTTCATGCCCCAAAGCTCTCTCCATTATCAAT
GACACAGTTGTTAAGGCAGTCCAGAAAGAACTCCGCATGGGAGCTTCTTTGCTCCGACTTCAATTCCATGATTGCTTCGTTAAT
GGTTGTGACGGTTCTGTCTTACTGGATCAAACATCC
AACATAACGGGAGAGAAAGATGCGCTTCAGAATCAGAATTCTTTGAGGGGATTCGAAGTGGTTGACGACATAAAAGCGGAGCTCGAACATGCTTGTCCTGGAGTTGTCTCCTGTGCTGAC
ATTTTAACCGTTGCAGCTCGTGATTCTGTTGTCGCC
TTGGGCGGTCCTTCTTGGGCTGTGGAGCTAGGAAGAAGGGATTCTTTGAATGCAAGTAAAGAAGCAGCCGAGAAAGACCTCCCT
GTATTCTCCCATGATCTCGAGACTCTCACCGCACTCTTTGCAAGAAAGGGTTTCAATGCCTCCGAACTAGTGATTCTATCAG
GAGGTCACACCATTGGGAGTGCAGCATGTGTAACTTAT
AGAGTCCACATATACAACGACACATACATAGATCCCGTTTTCCGACAGTCTCTGCAATCGATTTGCAAATTTAGAGGTCCGATTGATCCTTTGGCGGCTCTTGATAACACGGCCGACGTC
TTCGACAACGAGTTCTTCAAAGATCTATTGCACTTGAAGGGTGTTCTTAGGACAGATCAAGTGCTTTACCATAATGCTACCACAGACGAGCTGGTGAAGACATATAGTAACAACTCTGCT
TTGTTTTTCTCTGATTTCGGAGCTGCAATGGTTAAGTTGGGAAAGCTCGACGTGCTTCTTGGATCGCAAGGACAAATCCGAACTAATTGCAGGAAAGTTAACGAATAG

Retrieve as FASTA