Entry information : CpapPrx17 (CpPOD11 / evm.model.supercontig_195.9)
Entry ID 8751
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-08-16 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx17 (CpPOD11 / evm.model.supercontig_195.9)
Name (synonym) CpapPrx17 (CpPOD11 / evm.model.supercontig_195.9)
Class Class III peroxidase     [Orthogroup: Prx024]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx17
start..stop
S start..stop
CclPrx109 402 1e-141 1..307 3..324
MePrx79 401 3e-141 1..306 4..323
PpePrx68 395 9e-139 1..307 1..326
HaPrx24 385 3e-135 1..310 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64959..65183 225 N° 2 65657..65787 131 N° 3 65882..66036 155 N° 4 66129..66589 461
join(64959..65183,65657..65787,65882..66036,66129..66589)


exon

Literature and cross-references CpapPrx17 (CpPOD11 / evm.model.supercontig_195.9)
DNA ref. Phytozome 11:   supercontig_195 (64959..66589)
Protein sequence: CpapPrx17 (CpPOD11 / evm.model.supercontig_195.9)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (299)
PWM (Da):   %s   35139.87 (32746.6)  
PI (pH):   %s   8.31 (8.38) Peptide Signal:   %s   cut: 25 range:25-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGFAALALVLVVISINLTGQCHAALQIGFYDRKCGLNNVESIVTQEVTKKFIKDRTIAAALIRMYFHDCFVKVCPNLSVRGYDVIDAAKDAVEAACPGVVSCADIIAMATRDAVSLVTGGRYNVETGRRDGLESLASNVVLPSPQMTVSQSVSVFAKKGFSPKDMVYLGGXHTVGFAHCVFFQDRLYNFQNTGKPDPTMNSTLLQALRFMCPQNSLRNNAVNLDQNPSSSFTVDNSFYKQILLNRGILQIDQELALDSITKDIVKGIATSNDFITKFAEAMVKLGRTEVLTDTQGEIRRSCRSVNNNNNNSNNSFLTKIFP

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Short sequence after 'FHDC' is missing because of NNNN in DNA sequence). join(64959..65183,65657..65787,65882..66036,66129..66586)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTTTTGCTGCACTGGCACTAGTTCTTGTTGTTATCTCTATAAACTTGACAGGCCAATGTCATGCTGCTCTTCAAATAGGATTTTATGACAGAAAATGTGGTTTGAATAACGTC
GAGTCGATTGTCACTCAAGAAGTCACAAAAAAATTCATCAAGGATCGAACAATTGCAGCTGCACTTATTCGCATGTACTTCCATGATTGTTTTGTCAAGGTATGT
ATCATAATCTATTTT
TTTCTTTATCGATATGCAAATAATAATAAATTTGATCATTTCTTATCATATAAGTGTCATGCCTTAGAGTTTAAGCATCACTCGCTCAGTACTTAAATTGCCGTGAGTTCAATAATTGCA
TATTATCTCAGTATGGAATTAAAATATCAATATCTTCATCATTCAAAATTTTAATATTCTTAATATTCTCATATTATAATTTACACGAGATTTAAGATTGCACCAGCTGAAAAGACCAAG
CTAACATGTCTTTAATATCATTTGAAACACCTCAAAACCCAAAGAATCTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCAAATCTAAGTGTAAGAGGCT
ATGATGTCATTGATGCAGCTAAGGATGCGGTGGAGGCAGCCTGCCCAGGAGTTGTGTCTTGTGCTGATATCATAGCTATGGCTACAAGAGATGCTGTTTCCCTGGTAAC
ATTTTTTCACT
TCATCTTCCTTTTTAGATAAATGTGTACAAACATATATTATAACCTGAAAGTTCTGTACGCACCCAATTTTCCTGCAGAGTAGAGGAGGAAGATACAATGTAGAAACAGGCAGAAGAGAC
GGCCTTGAATCTCTTGCTTCAAATGTTGTTCTCCCTTCACCGCAAATGACTGTTTCGCAATCTGTTTCTGTCTTTGCTAAGAAAGGATTTTCTCCTAAAGACATGGTTTATCTTCTTG
GT
ATATATATAATATATAATTCCACTTGCTCAATTATATTTTCACTTGTTTCTTTCTCAAAATTCTGATTATTATTAATGGTATATATTTAGGTGGANNNCACACTGTTGGGTTTGCACATT
GTGTTTTCTTTCAGGATCGTTTGTATAATTTCCAGAACACAGGCAAACCAGACCCAACCATGAACTCAACATTGCTTCAGGCGCTCCGGTTCATGTGTCCTCAGAATTCACTACGAAATA
ATGCTGTAAATCTTGATCAGAATCCCTCTAGTTCATTCACTGTTGATAACTCCTTCTACAAGCAAATTCTTCTAAATAGAGGGATTCTCCAGATAGATCAAGAGCTAGCTCTGGATTCAA
TAACAAAGGACATAGTCAAGGGTATTGCTACCAGCAATGACTTCATAACGAAATTTGCTGAGGCAATGGTTAAGTTAGGTCGTACAGAAGTCCTTACGGACACACAAGGAGAGATTAGAA
GATCATGTCGTTCCGTCAACAACAACAACAACAATAGTAATAACAGCTTCTTAACAAAAATATTTCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTTTTGCTGCACTGGCACTAGTTCTTGTTGTTATCTCTATAAACTTGACAGGCCAATGTCATGCTGCTCTTCAAATAGGATTTTATGACAGAAAATGTGGTTTGAATAACGTC
GAGTCGATTGTCACTCAAGAAGTCACAAAAAAATTCATCAAGGATCGAACAATTGCAGCTGCACTTATTCGCATGTACTTCCATGATTGTTTTGTCAAGGTATGT
CCAAATCTAAGTGTA
AGAGGCTATGATGTCATTGATGCAGCTAAGGATGCGGTGGAGGCAGCCTGCCCAGGAGTTGTGTCTTGTGCTGATATCATAGCTATGGCTACAAGAGATGCTGTTTCCCTGGTAAC
AGGA
GGAAGATACAATGTAGAAACAGGCAGAAGAGACGGCCTTGAATCTCTTGCTTCAAATGTTGTTCTCCCTTCACCGCAAATGACTGTTTCGCAATCTGTTTCTGTCTTTGCTAAGAAAGGA
TTTTCTCCTAAAGACATGGTTTATCTTCTTG
GTGGANNNCACACTGTTGGGTTTGCACATTGTGTTTTCTTTCAGGATCGTTTGTATAATTTCCAGAACACAGGCAAACCAGACCCAACC
ATGAACTCAACATTGCTTCAGGCGCTCCGGTTCATGTGTCCTCAGAATTCACTACGAAATAATGCTGTAAATCTTGATCAGAATCCCTCTAGTTCATTCACTGTTGATAACTCCTTCTAC
AAGCAAATTCTTCTAAATAGAGGGATTCTCCAGATAGATCAAGAGCTAGCTCTGGATTCAATAACAAAGGACATAGTCAAGGGTATTGCTACCAGCAATGACTTCATAACGAAATTTGCT
GAGGCAATGGTTAAGTTAGGTCGTACAGAAGTCCTTACGGACACACAAGGAGAGATTAGAAGATCATGTCGTTCCGTCAACAACAACAACAACAATAGTAATAACAGCTTCTTAACAAAA
ATATTTCCTTAG

Retrieve as FASTA