Entry information : CpapPrx18 (CpPOD12 / evm.model.supercontig_198.1)
Entry ID 8752
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx18 (CpPOD12 / evm.model.supercontig_198.1)
Name (synonym) CpapPrx18 (CpPOD12 / evm.model.supercontig_198.1)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx18
start..stop
S start..stop
VvPrx61 473 1e-169 18..326 18..326
PtPrx55 463 1e-165 1..326 1..327
RcPrx43 462 3e-165 1..326 1..330
PtPrx91 461 5e-165 1..326 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1590..1811 222 N° 2 1926..2111 186 N° 3 2256..2421 166 N° 4 2664..3070 407
join(1590..1811,1926..2111,2256..2421,2664..3070)


exon

Literature and cross-references CpapPrx18 (CpPOD12 / evm.model.supercontig_198.1)
DNA ref. Phytozome 11:   supercontig_198 (1590..3070)
Protein sequence: CpapPrx18 (CpPOD12 / evm.model.supercontig_198.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35468.54 (32647.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.27 (9.39) Peptide Signal:   %s   cut: 29 range:27-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSKLVILSCLFLSICTIAFIPANAAGLKVGFYIETCPKAEFIVKKVVNEVMAKAPSLGGPLLRIHFHDCFVRGCDASVLLDSPTKQAEKDAVPNLRLRGFQIIDKVKAALEKECPGIVSCADIVALVARDVVVASRGPSWDVETGRRDGKVSRSLEALQNLPPPFFNITQLITSFTGKGLSVKDLVVLSGGHTIGIAFCPSFSNRLYNFTGKGDSDPTMDPNYIAKLKDKCKPGDQKTFVEMDPGSFKTFDDHYYSLVIKRRGLLESDAALLNNKETRDYVKLQATSHGSTFFKDFGVSMVKMGRIGVITGKAGEIRKVCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGTTCAAAGCTTGTAATTCTGTCATGTTTGTTTCTCTCAATATGTACTATCGCCTTTATCCCTGCAAATGCAGCGGGACTGAAAGTAGGGTTTTACATAGAGACATGTCCAAAA
GCCGAGTTCATTGTCAAGAAGGTAGTTAATGAGGTCATGGCCAAGGCCCCTTCGCTAGGCGGCCCTCTCTTGAGGATTCATTTCCACGATTGTTTTGTTAGA
GTAAGTTCATATTTCTCT
TACAACCCAAATGCATGCTATCATTTTATCTCATCTTTCATCATGTGTGTATGTATATATATATGTATGACTGGACATGTATATATATTTAAACAGGGATGTGATGCGTCAGTATTGTTG
GATTCCCCAACAAAGCAAGCTGAAAAGGATGCCGTTCCAAATTTAAGACTCAGAGGATTCCAAATCATTGATAAAGTCAAAGCAGCCTTGGAAAAGGAGTGTCCCGGCATTGTATCGTGC
GCTGATATTGTTGCTTTAGTAGCTAGAGACGTCGTTGTTGCT
GTATGTATATATATATACACATTGAAATATAACATACATCTTTTTGTAAATTAGTGTTACATTAATCATCTCAATATG
TATATCTATATATATATATATATATACACACTTAATTAAGCTATATATGGCTTATACTTGTCTCAGTCAAGAGGACCATCTTGGGACGTGGAAACAGGAAGGAGAGATGGAAAGGTTTCC
AGGTCTTTGGAGGCCTTGCAAAACCTACCGCCACCTTTCTTCAACATTACTCAATTGATTACTTCTTTTACAGGAAAGGGTCTTAGCGTCAAGGATCTTGTTGTTCTATCAG
GTACTGAT
TAAGCTTCTTGTTCCATCTTTGCAGCTTTGTGTATATATATAGACATATGTACATTTATATTACTTACAGAAGTTTTATTATTCATGTATATTTACACATATACGGACAATGATTAGTTC
AATTTATGTCAGTAGTGCTCTAAGAGTTCAATTCCAAATGCATTGATAGAATTTGGCTTTTAAAATTATTTGGTGAAACACATACAATTAACTCAAGATTAAATTGAAATTTAGGAGGGC
ATACGATTGGGATCGCATTTTGCCCATCATTCAGCAATCGTCTTTACAACTTCACTGGAAAAGGAGACAGTGACCCCACAATGGATCCAAATTACATAGCAAAGTTAAAGGACAAATGTA
AGCCAGGAGACCAGAAGACATTTGTAGAGATGGACCCAGGCAGCTTTAAGACCTTTGACGATCATTACTACAGTCTTGTCATCAAAAGAAGAGGTCTCCTTGAGTCTGATGCAGCTCTAC
TTAACAACAAGGAGACTAGAGATTATGTCAAGCTTCAAGCCACCAGCCATGGCTCCACTTTCTTCAAGGACTTTGGTGTGTCCATGGTAAAGATGGGAAGGATTGGGGTGATCACAGGCA
AGGCTGGTGAGATCAGAAAAGTTTGCAGTAAGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGTTCAAAGCTTGTAATTCTGTCATGTTTGTTTCTCTCAATATGTACTATCGCCTTTATCCCTGCAAATGCAGCGGGACTGAAAGTAGGGTTTTACATAGAGACATGTCCAAAA
GCCGAGTTCATTGTCAAGAAGGTAGTTAATGAGGTCATGGCCAAGGCCCCTTCGCTAGGCGGCCCTCTCTTGAGGATTCATTTCCACGATTGTTTTGTTAGA
GGATGTGATGCGTCAGTA
TTGTTGGATTCCCCAACAAAGCAAGCTGAAAAGGATGCCGTTCCAAATTTAAGACTCAGAGGATTCCAAATCATTGATAAAGTCAAAGCAGCCTTGGAAAAGGAGTGTCCCGGCATTGTA
TCGTGCGCTGATATTGTTGCTTTAGTAGCTAGAGACGTCGTTGTTGCT
TCAAGAGGACCATCTTGGGACGTGGAAACAGGAAGGAGAGATGGAAAGGTTTCCAGGTCTTTGGAGGCCTTG
CAAAACCTACCGCCACCTTTCTTCAACATTACTCAATTGATTACTTCTTTTACAGGAAAGGGTCTTAGCGTCAAGGATCTTGTTGTTCTATCAG
GAGGGCATACGATTGGGATCGCATTT
TGCCCATCATTCAGCAATCGTCTTTACAACTTCACTGGAAAAGGAGACAGTGACCCCACAATGGATCCAAATTACATAGCAAAGTTAAAGGACAAATGTAAGCCAGGAGACCAGAAGACA
TTTGTAGAGATGGACCCAGGCAGCTTTAAGACCTTTGACGATCATTACTACAGTCTTGTCATCAAAAGAAGAGGTCTCCTTGAGTCTGATGCAGCTCTACTTAACAACAAGGAGACTAGA
GATTATGTCAAGCTTCAAGCCACCAGCCATGGCTCCACTTTCTTCAAGGACTTTGGTGTGTCCATGGTAAAGATGGGAAGGATTGGGGTGATCACAGGCAAGGCTGGTGAGATCAGAAAA
GTTTGCAGTAAGGTTAATTAA

Retrieve as FASTA