Entry information : CpapPrx23 (CpPOD13 / evm.model.supercontig_2.328)
Entry ID 8756
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx23 (CpPOD13 / evm.model.supercontig_2.328)
Name (synonym) CpapPrx23 (CpPOD13 / evm.model.supercontig_2.328)
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx23
start..stop
S start..stop
CpapPrx25 322 4e-112 9..213 15..218
GhPrx13 309 7e-107 21..213 21..212
GaPrx07 306 3e-106 21..213 3..194
MePrx83 305 3e-105 13..213 7..206
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3802123..3802143 21 N° 2 3801794..3801988 195 N° 3 3801423..3801614 192 N° 4 3801070..3801246 177
N° 5 3800898..3800951 54  
complement(join(3800898..3800951,3801070..3801246,3801423..3801614,3801794..3801 988,3802123..3802143))


exon

Literature and cross-references CpapPrx23 (CpPOD13 / evm.model.supercontig_2.328)
DNA ref. Phytozome 12:   supercontig_2 (3802143..3800898)
Protein sequence: CpapPrx23 (CpPOD13 / evm.model.supercontig_2.328)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   213 (188)
PWM (Da):   %s   22934.94 (20148.6)  
PI (pH):   %s   7.73 (8.12) Peptide Signal:   %s   cut: 26 range:26-213
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYATDDNAIFARLCLLLLLSNNSYAQLSPDFYAETCPKVLVTVRSVLRDAVAKEPRMGASLLRLHFHDCFVNGCDASVLLDDTPTFVGEKTAVANNNSLRGYEVVDAIKVKLEEVCPGIVSCADILAIAARDSVVLLGGPNWIVKLGRRDSKTASLASANSGVIPPPSATLNQLINRFQAQGLSPTDLIALTGMNHTIGKIRCVLFRDRIYNE

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to NNNNNNN in DNA sequence).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATGCCACTGATGATAACGTGAGTTTCAACGAAATCCAAAATATATAACCAATATTGATCAGATCTACACCCTTTTATTTGGCTTGTAATTTGTAAATGATTGGGTTTCAACAATAC
TGAAAATGGTCTGTTCTTGTTCTTCTTGTTTGAAGGCCATTTTTGCAAGGCTATGTTTGCTTTTGCTCCTGTCAAACAACTCTTATGCCCAGCTTTCTCCAGATTTCTACGCTGAAACTT
GTCCGAAAGTACTCGTTACTGTAAGATCGGTACTTCGAGATGCCGTAGCAAAAGAACCGCGTATGGGTGCTTCTCTTCTTCGATTGCACTTTCATGATTGTTTTGTCAAC
GTAATTTTCT
TAGTTGATCTTCTTCTTCATCTTCTCTGTCTTTCGTTTTTCTTTCTGCAACTAAATATACATATATATATGTGTGTGTGTGTAATGATGTTGTTAATTTTTATATGTTTTCTTAGTTAAC
CAAATTGCTTTGGAGAGTTTAAAAACTTCTCATGTCTATTTTATTATAGGGATGTGATGCATCGGTTCTCTTAGATGACACTCCTACTTTTGTTGGAGAAAAAACCGCAGTTGCTAATAA
CAATTCTTTGAGAGGATACGAAGTCGTCGATGCCATAAAAGTCAAGTTAGAGGAAGTATGTCCCGGTATTGTTTCATGTGCTGATATTTTAGCAATTGCAGCTCGTGACTCGGTTGTACT
T
GTAAGTTCTTAATTTTTATCCAGCTTTAACTAATCATGTTTCTTTTTTTTATTTCAATCAAATTTAGAAATTAATGATCAAGAATCTGAAAACTGGTAAAATATGTTTCATCAGATTAG
ATAGTATTAGTGTTCATCGTTGTATACATATATATAATTACTCATGTTATGTTGCAGCTCGGAGGGCCTAACTGGATTGTTAAACTAGGAAGAAGGGATTCAAAGACAGCTAGTCTTGCA
TCTGCTAACAGTGGTGTAATCCCTCCTCCATCCGCTACACTTAATCAACTCATCAATAGGTTTCAAGCTCAAGGACTCTCACCTACGGACTTAATTGCCTTAACTGGTATGAAC
TTCTCC
AATTCTAAAATTAAAATAGATATTTAAATTTCTATCAAATTAATAATTTTAATTGCATAAATTGGTTTTCAAAAAAAAAAAAAAATTGTGATTTGTATATATTGTAGGTGGACACACGAT
TGGAAAAATAAGATGTGTACTTTTCAGAGATCGTATTTACAATGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATGCCACTGATGATAACGCCATTTTTGCAAGGCTATGTTTGCTTTTGCTCCTGTCAAACAACTCTTATGCCCAGCTTTCTCCAGATTTCTACGCTGAAACTTGTCCGAAAGTACTC
GTTACTGTAAGATCGGTACTTCGAGATGCCGTAGCAAAAGAACCGCGTATGGGTGCTTCTCTTCTTCGATTGCACTTTCATGATTGTTTTGTCAAC
GGATGTGATGCATCGGTTCTCTTA
GATGACACTCCTACTTTTGTTGGAGAAAAAACCGCAGTTGCTAATAACAATTCTTTGAGAGGATACGAAGTCGTCGATGCCATAAAAGTCAAGTTAGAGGAAGTATGTCCCGGTATTGTT
TCATGTGCTGATATTTTAGCAATTGCAGCTCGTGACTCGGTTGTACTT
CTCGGAGGGCCTAACTGGATTGTTAAACTAGGAAGAAGGGATTCAAAGACAGCTAGTCTTGCATCTGCTAAC
AGTGGTGTAATCCCTCCTCCATCCGCTACACTTAATCAACTCATCAATAGGTTTCAAGCTCAAGGACTCTCACCTACGGACTTAATTGCCTTAACTGGTATGAAC
CACACGATTGGAAAA
ATAAGATGTGTACTTTTCAGAGATCGTATTTACAATGAA

Retrieve as FASTA