Entry information : CpapPrx25 (CpPOD14 / evm.model.supercontig_2.330)
Entry ID 8757
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-08-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx25 (CpPOD14 / evm.model.supercontig_2.330)
Name (synonym) CpapPrx25 (CpPOD14 / evm.model.supercontig_2.330)
Class Class III peroxidase    [Orthogroup: Prx055]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx25
start..stop
S start..stop
PpePrx20 492 4e-177 3..328 2..325
CclPrx07 484 6e-174 9..328 4..323
CsPrx15 484 6e-174 9..328 4..323
GhPrx13 477 3e-171 28..328 22..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3814479..3814712 234 N° 2 3813680..3813871 192 N° 3 3813397..3813565 169 N° 4 3812896..3813287 392
complement(join(3812896..3813287,3813397..3813565,3813680..3813871,3814479..3814 712))


exon

Literature and cross-references CpapPrx25 (CpPOD14 / evm.model.supercontig_2.330)
DNA ref. Phytozome 12:   supercontig_2 (3814712..3812896)
Protein sequence: CpapPrx25 (CpPOD14 / evm.model.supercontig_2.330)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   35840.64 Transmb domain:   %s   i7-29o
PI (pH):   %s   9.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSSSSFRPIIVIVTLTFLVFFMGASHAQLSKNFYAKTCPQALAAVKYVVRAAVAKELRMGASLLRMHFHDCFVNGCDASVLLDDTPTFIGEKTALPNNNSLRGFEVVDAIKAKVEKLCPGVVSCADILTIAARDSVELLGGPSWTVKLGRRDAKTTSLAAANSGVIPPPTATLDQLITRFRAQGLSPRDLVALSGAHTIGKIRCLLFRDRIYNETNIDPLFAKIRQKTCPRTVGVGDDNLAPFDFKTPTTFDNQYYKNLLNQKGLLHSDQILFNGDSADSLVKKYSNNPNIFISDFVKAMIRMGDNKPLTGSNGEIRKNCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTCTTCTTCTTCTTTTAGACCCATTATTGTAATTGTAACGTTAACGTTTCTTGTATTCTTCATGGGCGCCTCCCATGCTCAGCTCTCTAAAAACTTCTACGCTAAA
ACTTGTCCTCAAGCCCTCGCCGCTGTTAAGTATGTTGTTCGAGCTGCCGTCGCCAAAGAGCTCCGCATGGGCGCCTCTCTACTTCGCATGCACTTTCACGACTGTTTTGTCAAT
GTAAAT
ATTCTTTTCTCTTTCTATCTCTCTCTCTCTCTCTATGTTATATACATATAAAATATGTGTGCGCTTTTTCCTTATTATTGCATATGTGATATATATGTTGTTGATAAAATTGTTGATAAA
TATGATATACAAAAGAATGGAGAAAGCCAGTGTCATTATGACCAAAAAGGATAGCTATCTACTTTAATTATTAGACGACTCTGTGTTTGCATTATATATATATAGATAGATAGTTACGTA
TAAAGAAAATTATAAATGACTTCATTAAATGGGACGTGTGGTTCCCATACTATTGAAAATTATGCGTACTTAGTATAATCTTCATTCAAGGGCCACAGTAATATGAAGGACACTAGTCCA
TTCAGAATGGTTTACCTGATACATATGCAAACCAAATTAACAACAAAAACCCAAATCAAATACAAACCTTATATATATATATATATATATATATATATATATATATCATGTCAACTTCTA
TTTTTATTTTCCTGCCTACTTCTTTCCCTTTTTTATTTAAATAAAATAACGTCATAAACAATTTAAACTCATAACCATAATGATGTGATTTCATAACTTATAAATGTTTTGTGACTTATA
GGGTTGTGATGCATCGGTCCTCTTAGATGACACTCCTACATTTATTGGAGAAAAAACTGCACTTCCTAATAACAATTCTTTAAGAGGATTTGAAGTTGTTGATGCTATCAAAGCTAAGGT
GGAGAAATTGTGTCCTGGAGTTGTTTCATGTGCTGATATTTTAACTATAGCAGCTCGTGATTCTGTTGAACTT
GTAAGTTAATTTTCGTTAATCTTACTTAAATAAATTATTTATTTTTA
ATTAAAATTTATTTTTTAATAGAATATATATTTTCTATTATTGATTAATTCTTAATTTATATTGTAGCTTGGAGGGCCTAGTTGGACAGTTAAATTAGGAAGAAGGGATGCCAAGACAAC
TAGCCTTGCCGCTGCCAACAGTGGTGTCATTCCTCCTCCAACAGCTACACTTGACCAACTTATCACAAGATTTCGAGCTCAAGGTCTCTCTCCTAGAGACTTGGTTGCATTATCTG
GTAT
AAATTTTTACACTTTTCAAAATTCATTTATATACATATTTATAAGATTTAACTTTATTGAATCAATAAATATTTAATGAGATACATATTTATATGTGTTTTATAGGTGCGCATACAATTG
GAAAGATAAGATGTTTGCTTTTTAGGGATCGTATATATAATGAGACCAACATCGATCCATTATTTGCCAAGATTAGACAAAAGACTTGTCCGAGAACTGTCGGAGTGGGAGATGATAATT
TAGCACCTTTTGACTTCAAAACTCCTACTACTTTTGATAACCAATATTATAAGAATCTTTTGAACCAGAAGGGTCTTCTTCACTCTGATCAAATACTATTTAATGGTGACTCTGCAGATT
CTTTAGTTAAAAAGTACAGCAACAATCCTAATATCTTTATTTCTGATTTTGTCAAGGCAATGATAAGGATGGGAGATAACAAACCACTTACCGGATCAAATGGTGAGATTAGGAAAAATT
GTAGGAGGCCTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTCTTCTTCTTCTTTTAGACCCATTATTGTAATTGTAACGTTAACGTTTCTTGTATTCTTCATGGGCGCCTCCCATGCTCAGCTCTCTAAAAACTTCTACGCTAAA
ACTTGTCCTCAAGCCCTCGCCGCTGTTAAGTATGTTGTTCGAGCTGCCGTCGCCAAAGAGCTCCGCATGGGCGCCTCTCTACTTCGCATGCACTTTCACGACTGTTTTGTCAAT
GGTTGT
GATGCATCGGTCCTCTTAGATGACACTCCTACATTTATTGGAGAAAAAACTGCACTTCCTAATAACAATTCTTTAAGAGGATTTGAAGTTGTTGATGCTATCAAAGCTAAGGTGGAGAAA
TTGTGTCCTGGAGTTGTTTCATGTGCTGATATTTTAACTATAGCAGCTCGTGATTCTGTTGAACTT
CTTGGAGGGCCTAGTTGGACAGTTAAATTAGGAAGAAGGGATGCCAAGACAACT
AGCCTTGCCGCTGCCAACAGTGGTGTCATTCCTCCTCCAACAGCTACACTTGACCAACTTATCACAAGATTTCGAGCTCAAGGTCTCTCTCCTAGAGACTTGGTTGCATTATCTG
GTGCG
CATACAATTGGAAAGATAAGATGTTTGCTTTTTAGGGATCGTATATATAATGAGACCAACATCGATCCATTATTTGCCAAGATTAGACAAAAGACTTGTCCGAGAACTGTCGGAGTGGGA
GATGATAATTTAGCACCTTTTGACTTCAAAACTCCTACTACTTTTGATAACCAATATTATAAGAATCTTTTGAACCAGAAGGGTCTTCTTCACTCTGATCAAATACTATTTAATGGTGAC
TCTGCAGATTCTTTAGTTAAAAAGTACAGCAACAATCCTAATATCTTTATTTCTGATTTTGTCAAGGCAATGATAAGGATGGGAGATAACAAACCACTTACCGGATCAAATGGTGAGATT
AGGAAAAATTGTAGGAGGCCTAATTAA

Retrieve as FASTA