Entry information : CpapPrx28 (evm.model.supercontig_3.163)
Entry ID 8759
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-11-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: CpapPrx28 (evm.model.supercontig_3.163)
Name (synonym) CpapPrx28 (evm.model.supercontig_3.163)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx28
start..stop
S start..stop
CclPrx110 490 3e-176 11..329 11..328
CsPrx21 486 1e-174 11..329 11..328
MePrx120 480 2e-172 16..329 16..330
StPrx23 475 1e-170 11..329 6..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1220377..1220601 225 N° 2 1220084..1220275 192 N° 3 1219817..1219979 163 N° 4 1219327..1219736 410
complement(join(1219327..1219736,1219817..1219979,1220084..1220275,1220377..1220 601))


exon

Literature and cross-references CpapPrx28 (evm.model.supercontig_3.163)
DNA ref. Phytozome 11:   supercontig_3 (1220601..1219327)
Protein sequence: CpapPrx28 (evm.model.supercontig_3.163)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331
PWM (Da):   %s   35502.2 Transmb domain:   %s   i7-26o
PI (pH):   %s   9.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSGKKSNNGAVVTLAAIVIICSLQNVLSQLRVGFYQNSCGRVEFIVKDEVQRAFVKDKGIAAGLVRMHFHDCFVRGCDGSVLIDSTSTNKAEKDSPVNNPSLRGIEVIDSVKTRLEAVCRGVVSCADIIAFAARDSIQITGGPVYDVPAGRRDGRISVASETRILPPPTFNLNQLTQLFASKGFTQEEMVTLSGAHTIGRAHCTSFSARLYNFSGTNKQDPSLDTIYAAQLKKQCPQKSTNPNVVVNMNPATPVVTDTAYYADVLANRSLFTSDATLLTSPATATQVHQNARNALLWRTKFAAAMVKMGQLDILTGAAGEIRAHCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGGAAGAAGAGTAACAATGGAGCAGTGGTAACTTTGGCTGCTATTGTGATAATTTGTAGCCTACAAAATGTTTTGAGTCAGCTCAGGGTTGGATTCTATCAAAATTCATGTGGC
CGAGTCGAGTTTATCGTTAAGGATGAAGTTCAAAGAGCATTTGTTAAGGACAAAGGAATAGCAGCTGGACTCGTTAGAATGCACTTTCATGATTGTTTTGTTAGA
GTAAGTACTTTCGAG
ACAAATAAGTTTTTCGCTCTCAACCTTGTAGTTGAAAATTTAGATCTTCTTGGTTTTTAACGATCTTTGTTGTATGATTAAATCAGGGCTGCGATGGCTCGGTGCTTATCGACTCGACTT
CTACGAACAAGGCAGAGAAAGACTCACCTGTCAATAATCCGAGTCTTCGAGGAATTGAAGTCATAGATAGTGTCAAGACTAGACTTGAAGCTGTTTGTCGAGGAGTTGTTTCATGTGCTG
ATATTATTGCTTTCGCCGCAAGAGATAGTATCCAGATT
GTAAGAACTATTTTTTACTTAATACTCTCTGAATTATAATTTTCTTTGTTTTTATTTACTAATTGTTGTATAAATCAATTTT
TATATCGTTTTCTTTGGTGTAGACAGGAGGGCCTGTTTATGATGTTCCAGCGGGAAGAAGAGACGGCAGGATTTCTGTAGCTTCAGAAACACGAATCTTACCTCCCCCAACTTTTAACCT
TAATCAACTCACTCAACTCTTTGCCAGCAAGGGTTTCACCCAGGAAGAAATGGTTACTCTCTCTG
GTAATTACTACATGCAGTGTATACATACATGTATATGTTTTAAATACGTATCTGA
GGTAATATATACATGTGTTATACAGGAGCGCACACCATAGGGCGAGCTCACTGCACATCATTCAGTGCCAGACTTTACAATTTCAGCGGCACGAATAAGCAGGACCCGAGTCTGGACACA
ATTTACGCAGCTCAATTGAAGAAGCAGTGTCCGCAAAAGAGCACCAATCCAAACGTGGTGGTAAACATGAACCCAGCTACCCCGGTAGTGACCGACACAGCCTACTACGCGGATGTGCTG
GCAAACCGGAGCTTGTTCACCTCAGATGCTACGCTGCTCACAAGCCCTGCAACAGCAACTCAAGTCCACCAAAATGCCAGGAACGCCCTGCTTTGGAGGACGAAATTTGCAGCGGCAATG
GTCAAGATGGGCCAGCTTGATATCTTGACGGGGGCCGCAGGAGAGATTCGAGCACATTGCAGAGTGGTGAACGGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGGAAGAAGAGTAACAATGGAGCAGTGGTAACTTTGGCTGCTATTGTGATAATTTGTAGCCTACAAAATGTTTTGAGTCAGCTCAGGGTTGGATTCTATCAAAATTCATGTGGC
CGAGTCGAGTTTATCGTTAAGGATGAAGTTCAAAGAGCATTTGTTAAGGACAAAGGAATAGCAGCTGGACTCGTTAGAATGCACTTTCATGATTGTTTTGTTAGA
GGCTGCGATGGCTCG
GTGCTTATCGACTCGACTTCTACGAACAAGGCAGAGAAAGACTCACCTGTCAATAATCCGAGTCTTCGAGGAATTGAAGTCATAGATAGTGTCAAGACTAGACTTGAAGCTGTTTGTCGA
GGAGTTGTTTCATGTGCTGATATTATTGCTTTCGCCGCAAGAGATAGTATCCAGATT
ACAGGAGGGCCTGTTTATGATGTTCCAGCGGGAAGAAGAGACGGCAGGATTTCTGTAGCTTCA
GAAACACGAATCTTACCTCCCCCAACTTTTAACCTTAATCAACTCACTCAACTCTTTGCCAGCAAGGGTTTCACCCAGGAAGAAATGGTTACTCTCTCTG
GAGCGCACACCATAGGGCGA
GCTCACTGCACATCATTCAGTGCCAGACTTTACAATTTCAGCGGCACGAATAAGCAGGACCCGAGTCTGGACACAATTTACGCAGCTCAATTGAAGAAGCAGTGTCCGCAAAAGAGCACC
AATCCAAACGTGGTGGTAAACATGAACCCAGCTACCCCGGTAGTGACCGACACAGCCTACTACGCGGATGTGCTGGCAAACCGGAGCTTGTTCACCTCAGATGCTACGCTGCTCACAAGC
CCTGCAACAGCAACTCAAGTCCACCAAAATGCCAGGAACGCCCTGCTTTGGAGGACGAAATTTGCAGCGGCAATGGTCAAGATGGGCCAGCTTGATATCTTGACGGGGGCCGCAGGAGAG
ATTCGAGCACATTGCAGAGTGGTGAACGGC

Retrieve as FASTA