Entry information : SbPrx04 (Sobic.001G189000.1[2.1] / SB01G016600[1.4])
Entry ID 876
Creation 2006-01-06 (Christophe Dunand)
Last sequence changes 2006-01-06 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx04 (Sobic.001G189000.1[2.1] / SB01G016600[1.4])
Name (synonym) SbPrx04 (Sobic.001G189000.1[2.1] / SB01G016600[1.4])
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Seedlings
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx04
start..stop
S start..stop
ZmPrx92 575 0 23..357 24..355
SiPrx146 561 0 27..357 23..345
OsPrx49 504 0 48..357 43..348
ZmaPrx13 350 2e-120 44..357 39..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16742377..16742643 267 N° 2 16741759..16741947 189 N° 3 16741469..16741667 199 N° 4 16739972..16740390 419
complement(join(16739972..16740390,16741469..16741667,16741759..16741947,1674237 7..16742643))


exon

Literature and cross-references SbPrx04 (Sobic.001G189000.1[2.1] / SB01G016600[1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_1 (16742643..16739972)
EST ref. GenBank:   CD220064 [3' end]   BE361791 [Fragment]
Protein sequence: SbPrx04 (Sobic.001G189000.1[2.1] / SB01G016600[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (331)
PWM (Da):   %s   38574.96 (35980.4)  
PI (pH):   %s   9.35 (9.20) Peptide Signal:   %s   cut: 29 range:27-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAARPVLPSPALLLLPLLLLVTASSGAAHGYGHGGDDDDGAGKLRVGFYKDSCPDAEAIVRRVVAKAVHEDPTANAPLLRLHFHDCFVRGCEGSVLINSTKGNKAEKDAKPNLTLDAFDVIDDIKDALEKRCPGTVSCADILAIAARDAVSLATKAVTKGRWSKDGNLYQVETGRRDGRVSSAKEAVKNLPDSMDGIRKLIRRFASKNLSIKDLAVLSGAHAIGKSHCPSIAKRLRNYTAHRDSDPTLDGAYAAELRRTCRSRRDKTTELEMVPGSSTTFDTAYYGLVVKRTALFHSDEALLRNQETRALVYRYRDAAAGSEQAFLRDFGVSMVNMGRVGVLTGDQGEIRKRCAFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGCGCCCGGTTCTTCCTTCTCCTGCTCTCCTCTTGCTTCCCCTGCTGCTGCTTGTGACTGCTTCGTCAGGTGCCGCCCATGGCTACGGCCACGGCGGCGACGACGACGACGGT
GCGGGTAAGCTCAGGGTCGGGTTCTACAAGGACTCGTGCCCGGACGCCGAGGCGATCGTCCGCAGGGTCGTCGCCAAGGCCGTCCACGAGGATCCCACGGCCAATGCGCCGCTGCTCAGG
CTTCACTTCCACGACTGCTTCGTCAGG
GTACGCTTCAGATTCCATTGCTGTCTTGTACTTCTAGTAGTAGATTAGTAGTATATGGTTTCACTGCAAAGTGCCCGGCTGTTTTCTTTTCAA
CGGGATTCAGTGGTATCCAATGCAGCTTCTAATGATTTTCACTCAGTTGTGCTTGTGCACGAACTAACCTGACTGAGACTCTTTTTCTTTCTCTCTTAAAAAAAGAAAAGAAAAGAAAAG
CGTCTCTGAAGCTTTATCTGGAGAAGAGGCAGAAAGAGCAAAGATTCCCCACACGCGAATCTCTCAAAAGCGTCTCATTTTCTTTGCTGGATGTTGTTTCGAGTTGAAACAAACTACTAC
TACTCTACATCACTTTCACTTCAAGTGATACTCTGAAAATCCGTTCCCTGTTCCCTGACCTTCGTCCCCATTGGCCAATCGTCGCCATTGCTGCAGGGCTGCGAGGGGTCCGTGCTCATC
AACTCCACCAAGGGCAACAAGGCGGAGAAGGACGCCAAGCCCAACCTCACGCTGGACGCCTTCGACGTCATCGACGACATCAAGGACGCGCTGGAGAAGCGATGCCCCGGCACCGTCTCC
TGCGCCGACATCCTCGCCATCGCCGCCAGGGACGCCGTCTCGCTG
GTACTGTACGCTGCCTGAATACCTGATTCCTTCCTGGAAGCAGAGCCATGGCTAATGGCTGAGGCTGACTGCAAA
CCAACAATGCAAACAGGCCACCAAGGCGGTGACCAAGGGAAGGTGGAGCAAGGACGGGAACCTCTACCAGGTGGAGACCGGCAGGCGGGACGGCCGCGTCTCCAGCGCCAAGGAGGCCGT
CAAGAACCTGCCGGACTCCATGGACGGCATCCGCAAGCTCATCAGGAGGTTCGCCTCCAAGAACCTCAGCATCAAGGATCTCGCTGTTCTCTCAG
GTACAGTACACACAGTACCATAGTA
TATTTATTAATATAATCTGCACTGTTTCGACGGGCTTTGTTTGTTTAATTGTGCAGCTAGTACTGCTGCTGTATTTCAGCTCATAGCACGCAGAGGTCTCTCTTTTTAAATGAAGTTTAT
TTTCTGGAGACCTACACCTACACTACACGTGTGTCGGTGTCGCACACTTGCACTACTGCTTACTGAATCTGAAACTGAAATATAGGAAATGTAGCTTATGTGGTAAAAAATCAGGGGAAA
AAAACGTCTACTGGGTTTTTTTATTTGAAGACGGAAAATACAAAGAAAAAGAGAAAAATGTTACAACTTGGTATCGTCAGATCTACTTATTAAAAGTTATTGACTTTTCATTTGACGAAG
ATAAAAATGGCTTAGATTGTATCTTGAATGAAATCCTCAAGGATTTTCTTTTTCAAAAGTGAAGGGCACACCACTCAAGAATCAGTTAATACGGCATGGTCATCAGTCATCACAATCTGT
AGTACTGACTTGTTCCATGTTTTTTTTTTGCAATTCATATTGGTCCCTGTCACGTGGCATGTAGAATTATATAGACCTTGTTTAGTTCACTCAACAAAATCAAAAATTTTTCAAGATTTC
TCGTCACATCAAATCTTACGGCACATGTAAATATAGTAAAAAAATAAAAACTAATTACACAGTTTGCCTGTAAATCGCGACATAAATCTTTTAAGCTTAGTTTATAATTGGATAATATTT
GTTACAAACAAACGAAAGTGCTACAGGCCTCGAATCAAAAATTTTTGGAAACTAAACAAGGCCATAGTCTTCTTGAAAGGTGGCACTTTTGCGACTCAAGAAAAGGCAAGTTAGGAAATC
GAAATGTGGAGACAAGATTCTTTCACATTTCATTATAGTATACAGTACCCCTTAATTTCTCGTATTCGGATTTTCTCTACTGTATGTTTTTTTCTGGAATTGCTTGACCCCAAGCAAAGC
AAGTTTTCTTGAGATGGCTTGCAAACGAACTTGCACTTGGCTTTGTTGCCATCGTTGTGACCAAACAGCAATTACTCTCCTATATATATCCAGGTGCCCACGCGATCGGGAAATCGCACT
GCCCGTCGATCGCCAAGCGTCTGCGCAACTACACGGCGCACCGGGACAGCGACCCGACGCTGGACGGCGCGTACGCGGCGGAGCTGAGGCGGACGTGCCGGAGCCGCCGGGACAAGACGA
CGGAGCTGGAGATGGTGCCCGGCAGCTCCACGACGTTCGACACGGCCTACTACGGCCTGGTCGTGAAGCGGACGGCGCTCTTCCACTCCGACGAGGCGCTGCTCAGGAACCAGGAGACCA
GGGCGCTCGTCTACCGCTACAGGGACGCCGCCGCCGGGTCGGAGCAGGCGTTCCTGAGGGACTTTGGGGTGTCCATGGTGAACATGGGCAGGGTCGGCGTGCTCACCGGCGACCAGGGAG
AGATCAGGAAGAGATGTGCCTTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGCGCCCGGTTCTTCCTTCTCCTGCTCTCCTCTTGCTTCCCCTGCTGCTGCTTGTGACTGCTTCGTCAGGTGCCGCCCATGGCTACGGCCACGGCGGCGACGACGACGACGGT
GCGGGTAAGCTCAGGGTCGGGTTCTACAAGGACTCGTGCCCGGACGCCGAGGCGATCGTCCGCAGGGTCGTCGCCAAGGCCGTCCACGAGGATCCCACGGCCAATGCGCCGCTGCTCAGG
CTTCACTTCCACGACTGCTTCGTCAGG
GGCTGCGAGGGGTCCGTGCTCATCAACTCCACCAAGGGCAACAAGGCGGAGAAGGACGCCAAGCCCAACCTCACGCTGGACGCCTTCGACGTC
ATCGACGACATCAAGGACGCGCTGGAGAAGCGATGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAGGGACGCCGTCTCGCTG
GCCACCAAGGCGGTGACCAAGGGA
AGGTGGAGCAAGGACGGGAACCTCTACCAGGTGGAGACCGGCAGGCGGGACGGCCGCGTCTCCAGCGCCAAGGAGGCCGTCAAGAACCTGCCGGACTCCATGGACGGCATCCGCAAGCTC
ATCAGGAGGTTCGCCTCCAAGAACCTCAGCATCAAGGATCTCGCTGTTCTCTCAG
GTGCCCACGCGATCGGGAAATCGCACTGCCCGTCGATCGCCAAGCGTCTGCGCAACTACACGGCG
CACCGGGACAGCGACCCGACGCTGGACGGCGCGTACGCGGCGGAGCTGAGGCGGACGTGCCGGAGCCGCCGGGACAAGACGACGGAGCTGGAGATGGTGCCCGGCAGCTCCACGACGTTC
GACACGGCCTACTACGGCCTGGTCGTGAAGCGGACGGCGCTCTTCCACTCCGACGAGGCGCTGCTCAGGAACCAGGAGACCAGGGCGCTCGTCTACCGCTACAGGGACGCCGCCGCCGGG
TCGGAGCAGGCGTTCCTGAGGGACTTTGGGGTGTCCATGGTGAACATGGGCAGGGTCGGCGTGCTCACCGGCGACCAGGGAGAGATCAGGAAGAGATGTGCCTTCGTCAACTAG

Retrieve as FASTA