Entry information : CpapPrx31 (CpPOD17 / evm.model.supercontig_367.2)
Entry ID 8761
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-08-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx31 (CpPOD17 / evm.model.supercontig_367.2)
Name (synonym) CpapPrx31 (CpPOD17 / evm.model.supercontig_367.2)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx31
start..stop
S start..stop
PtPrx15 433 5e-154 25..315 36..326
ThasPrx66 427 2e-151 27..317 58..348
CsPrx40 423 6e-150 25..318 38..331
CclPrx22 423 6e-150 25..318 38..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22584..22657 74 N° 2 21316..22201 886  
complement(join(21316..22201,22584..22657))


exon

Literature and cross-references CpapPrx31 (CpPOD17 / evm.model.supercontig_367.2)
DNA ref. Phytozome 11:   supercontig_367 (22657..21319)
Protein sequence: CpapPrx31 (CpPOD17 / evm.model.supercontig_367.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320
PWM (Da):   %s   35878.02  
PI (pH):   %s   8.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDNKGQLAGRRKNGHYQMLQMAVYRFEEIVRQVVTDKQMQAPTTAAGVVRLFFHDCMVESCDASILIASTHNRKAERDHDINLSLPGDAFDVITRIKTALELECPGIVSCSDIIAIATRNLVVMVGGPHYEVRFGRKDGTVSDTSRVDASLAKTTTPIDQIITMFGEKGLSVQELVALLGAHTIGFTHCKEFAKRIYNFSPTSQNDPQMDPEYAEALRKLCMNHTMVPQMSAFNDVFTPGKFDNMYYKNLRRRMALLQSDQAVATDKRTRPFVDLYAANQTAFFEAFGRAMQKVSILGVKTGRKGEVRRRCDQFNNFHP

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Bad 5' end due to the NNNNNNN in DNA Ssequence).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATAAAGGCCAGCTAGCTGGACGGCGGAAGAACGGCCACTACCAAATGCTGCAGATGGCGGTCTACAGGTTATTTGGCAGGGGGCAGCCGATGACCGATGGATGGCAATCGGCA
GCAGCTGAAGAAGAATGTTACAAAAAGAAAACATGCAATTTTTTAAATTAGGTGAAGAGAGTATATGAAAGAAACTATTGAAAATAGAAGCACTTTTTAAAAGTTAGTGTTTCTATTTTT
TAATCTTTAGCACTTTTAATTTTTATTCTTGTAATTGTAAAGTACTTTAAAAATGCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCGTCAACTCCAAACTCACCGTAGACTACTACAAAAAATCATGCCCCAGGTTCGAGGAAATTGTCCGGCAAGT
CGTCACAGATAAGCAGATGCAGGCACCTACAACCGCCGCCGGCGTCGTCCGCCTTTTCTTCCACGATTGCATGGTTGAAAGTTGCGATGCCTCCATCCTCATTGCATCCACCCACAACAG
AAAAGCCGAGCGCGACCATGACATCAACCTCTCTCTCCCCGGCGATGCCTTTGACGTCATCACCCGCATCAAGACCGCCCTCGAGCTCGAATGTCCCGGCATTGTTTCCTGCTCAGACAT
TATTGCCATTGCAACGAGAAACTTGGTCGTCATGGTGGGTGGACCTCACTACGAGGTTCGATTTGGGCGGAAAGACGGCACCGTATCGGACACCAGCCGGGTAGACGCCAGCCTCGCTAA
AACCACCACACCAATTGACCAAATCATCACCATGTTCGGGGAAAAAGGGCTTTCGGTGCAAGAACTTGTTGCCCTCCTCGGGGCTCACACAATTGGATTCACGCATTGCAAGGAGTTCGC
TAAAAGAATTTATAATTTCAGCCCTACGTCGCAGAACGACCCGCAAATGGATCCGGAATACGCAGAGGCCTTGAGGAAACTGTGCATGAACCACACGATGGTGCCGCAAATGTCAGCGTT
CAACGACGTGTTCACCCCGGGAAAGTTTGATAACATGTATTATAAGAATCTGAGGAGGCGAATGGCGCTGCTTCAGTCAGATCAGGCGGTGGCGACAGACAAGAGGACGAGGCCGTTTGT
GGACTTGTACGCGGCTAATCAAACAGCATTCTTCGAGGCCTTTGGTCGAGCAATGCAGAAGGTTAGTATTTTGGGAGTGAAGACGGGCAGGAAAGGAGAGGTGCGACGCAGATGTGATCA
GTTTAACAATTTCCATCCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATAAAGGCCAGCTAGCTGGACGGCGGAAGAACGGCCACTACCAAATGCTGCAGATGGCGGTCTACAGGTTCGAGGAAATTGTCCGGCAAGTCGTCACAGATAAGCAGATGCAG
GCACCTACAACCGCCGCCGGCGTCGTCCGCCTTTTCTTCCACGATTGCATGGTTGAAAGTTGCGATGCCTCCATCCTCATTGCATCCACCCACAACAGAAAAGCCGAGCGCGACCATGAC
ATCAACCTCTCTCTCCCCGGCGATGCCTTTGACGTCATCACCCGCATCAAGACCGCCCTCGAGCTCGAATGTCCCGGCATTGTTTCCTGCTCAGACATTATTGCCATTGCAACGAGAAAC
TTGGTCGTCATGGTGGGTGGACCTCACTACGAGGTTCGATTTGGGCGGAAAGACGGCACCGTATCGGACACCAGCCGGGTAGACGCCAGCCTCGCTAAAACCACCACACCAATTGACCAA
ATCATCACCATGTTCGGGGAAAAAGGGCTTTCGGTGCAAGAACTTGTTGCCCTCCTCGGGGCTCACACAATTGGATTCACGCATTGCAAGGAGTTCGCTAAAAGAATTTATAATTTCAGC
CCTACGTCGCAGAACGACCCGCAAATGGATCCGGAATACGCAGAGGCCTTGAGGAAACTGTGCATGAACCACACGATGGTGCCGCAAATGTCAGCGTTCAACGACGTGTTCACCCCGGGA
AAGTTTGATAACATGTATTATAAGAATCTGAGGAGGCGAATGGCGCTGCTTCAGTCAGATCAGGCGGTGGCGACAGACAAGAGGACGAGGCCGTTTGTGGACTTGTACGCGGCTAATCAA
ACAGCATTCTTCGAGGCCTTTGGTCGAGCAATGCAGAAGGTTAGTATTTTGGGAGTGAAGACGGGCAGGAAAGGAGAGGTGCGACGCAGATGTGATCAGTTTAACAATTTCCATCCCTGA

Retrieve as FASTA