Entry information : CpapPrx35 (CpPOD20 / evm.model.supercontig_42.87)
Entry ID 8764
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx35 (CpPOD20 / evm.model.supercontig_42.87)
Name (synonym) CpapPrx35 (CpPOD20 / evm.model.supercontig_42.87)
Class Class III peroxidase    [Orthogroup: Prx225]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx35
start..stop
S start..stop
CpapPrx34 482 4e-173 1..319 1..323
CpapPrx38 426 2e-151 1..319 1..323
RcPrx54 398 5e-140 7..322 5..323
NtPrx10-1B 398 5e-140 2..322 8..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 777169..777567 399 N° 2 776873..777038 166 N° 3 776355..776767 413  
complement(join(776355..776767,776873..777038,777169..777567))


exon

Literature and cross-references CpapPrx35 (CpPOD20 / evm.model.supercontig_42.87)
DNA ref. Phytozome 12:   supercontig_42 (777567..776355)
mRNA ref. GenBank:   EX258454   EX276648   EX285911
Protein sequence: CpapPrx35 (CpPOD20 / evm.model.supercontig_42.87)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   34761.54 (32011.2) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.49 (8.50) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSTTVYFLIFLFAALGMHATLAYGQGTRVGFYSTTCPQVESIVRSAVQARFNTDPTIAPGLLRMHFHDCFVRGCDGSILIEGSNTEQTAIPNSNLRGFDVIQNAKTQLDSICPGVVSCSDILALAARDSVVLTGARSWPVPTGRRDGRVSLASEVGPNIPAFTDSVNEQKRKFSIKNLNTQDLVVLAGGHTIGTAACAVITGRLFNFNGTAGASDPSISPSFLPVLKSLCPQDGNAGTRVPLDTGSVDKFDTSYFTNLRDGKGVLQSDQGVVDRHFHQTYCPTILRP*CFQH*ICRSMIKMSNIGVLTGTQGEFRKVCGKLTKH

Retrieve as FASTA  
Remarks Partial sequence from genomic and 3 mRNA. Incorrect prediction from phytozome (3' end is missing. A part of missing seq is retrived but there are stops at 3' end maybe due to bad sequencing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTCTACTACTGTCTATTTCTTGATATTTTTGTTTGCTGCACTTGGCATGCATGCGACCTTAGCGTATGGTCAAGGTACCCGTGTCGGCTTCTACTCCACTACATGCCCACAAGTG
GAGTCGATCGTTAGATCAGCAGTGCAAGCTCGTTTTAATACCGACCCTACAATTGCTCCTGGGTTGCTCAGGATGCACTTTCATGATTGTTTTGTTCGTGGTTGTGATGGTTCGATCCTT
ATTGAGGGGTCAAACACTGAACAAACTGCTATTCCTAACTCAAATTTAAGAGGATTTGATGTTATTCAAAATGCCAAGACTCAACTTGATTCTATATGTCCTGGAGTTGTCTCTTGCTCT
GATATCCTTGCCCTTGCTGCACGTGATTCTGTGGTCCTG
GTAATTAGTAATATTTACTAATATATCATGTACTTCATTTTTTTTATCATATACGGTAGTATTCAACTTATTGCATATATA
ATAGATTATGTATATTAATTTATTTCAACTGCATATTAACATGATGCAGACTGGAGCACGTAGTTGGCCAGTTCCTACGGGGAGAAGAGATGGAAGAGTTTCACTGGCATCTGAAGTTGG
TCCCAACATTCCTGCATTTACTGACTCTGTTAATGAGCAAAAACGAAAATTTTCTATAAAAAATCTCAACACTCAGGATCTTGTCGTCCTTGCAG
GTTAGTGTTATTTCAAAATATCTAC
TGCTAAGTTTTCATTCATCTTCTTCATTAATAAGTTATAACTTGCTAATTATATATGTCTATATATTTTTCTATGAACAGGTGGACATACCATTGGAACTGCAGCATGTGCTGTAATTAC
AGGCAGACTATTCAACTTCAATGGAACAGCTGGTGCATCTGATCCTTCCATAAGCCCGTCATTTCTCCCAGTATTGAAATCTCTTTGTCCCCAAGATGGCAATGCAGGAACACGTGTACC
ATTAGACACAGGAAGTGTAGACAAATTTGACACATCTTACTTTACAAACTTGAGAGATGGCAAAGGAGTTCTCCAATCCGATCAAGGTGTTGTGGACAGACACTTCCACCAGACCTATTG
TCCAACGATTCTTCGCCCTTAATGCTTTCAGCATTGAATTTGCAGATCCATGATTAAAATGAGTAACATTGGAGTTCTAACTGGCACGCAAGGTGAATTTCGTAAAGTTTGCGGAAAATT
AACTAAGCATCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTCTACTACTGTCTATTTCTTGATATTTTTGTTTGCTGCACTTGGCATGCATGCGACCTTAGCGTATGGTCAAGGTACCCGTGTCGGCTTCTACTCCACTACATGCCCACAAGTG
GAGTCGATCGTTAGATCAGCAGTGCAAGCTCGTTTTAATACCGACCCTACAATTGCTCCTGGGTTGCTCAGGATGCACTTTCATGATTGTTTTGTTCGTGGTTGTGATGGTTCGATCCTT
ATTGAGGGGTCAAACACTGAACAAACTGCTATTCCTAACTCAAATTTAAGAGGATTTGATGTTATTCAAAATGCCAAGACTCAACTTGATTCTATATGTCCTGGAGTTGTCTCTTGCTCT
GATATCCTTGCCCTTGCTGCACGTGATTCTGTGGTCCTG
ACTGGAGCACGTAGTTGGCCAGTTCCTACGGGGAGAAGAGATGGAAGAGTTTCACTGGCATCTGAAGTTGGTCCCAACATT
CCTGCATTTACTGACTCTGTTAATGAGCAAAAACGAAAATTTTCTATAAAAAATCTCAACACTCAGGATCTTGTCGTCCTTGCAG
GTGGACATACCATTGGAACTGCAGCATGTGCTGTA
ATTACAGGCAGACTATTCAACTTCAATGGAACAGCTGGTGCATCTGATCCTTCCATAAGCCCGTCATTTCTCCCAGTATTGAAATCTCTTTGTCCCCAAGATGGCAATGCAGGAACACGT
GTACCATTAGACACAGGAAGTGTAGACAAATTTGACACATCTTACTTTACAAACTTGAGAGATGGCAAAGGAGTTCTCCAATCCGATCAAGGTGTTGTGGACAGACACTTCCACCAGACC
TATTGTCCAACGATTCTTCGCCCTTAATGCTTTCAGCATTGAATTTGCAGATCCATGATTAAAATGAGTAACATTGGAGTTCTAACTGGCACGCAAGGTGAATTTCGTAAAGTTTGCGGA
AAATTAACTAAGCATCAC

Retrieve as FASTA