Entry information : CpapPrx[P]37 (evm.model.supercontig_468.3)
Entry ID 8765
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapPrx[P]37 (evm.model.supercontig_468.3)
Name (synonym) CpapPrx[P]37 (evm.model.supercontig_468.3)
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx[P]37
start..stop
S start..stop
CpapPrx38 494 4e-178 9..325 10..327
GhPrx06 489 3e-176 8..325 10..328
CclPrx41 489 6e-176 1..325 1..325
CsPrx44 488 1e-175 1..325 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9196..9591 396 N° 2 8919..9081 163 N° 3 8394..8809 416  
complement(join(8394..8809,8919..9081,9196..9591))


exon

Literature and cross-references CpapPrx[P]37 (evm.model.supercontig_468.3)
DNA ref. Phytozome 11:   supercontig_468 (9591..8394)
Protein sequence: CpapPrx[P]37 (evm.model.supercontig_468.3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (300)
PWM (Da):   %s   35055.68 (32591.4) Transmb domain:   %s   i7-24o
PI (pH):   %s   7.18 (7.18) Peptide Signal:   %s   cut: 25 range:25-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGRSGLLILLFVLAAMAATSVYGQGTRVGYYYKTCPQAESIVRSTVQSHFRSDPTIAPGLLRIHFHDCFVRGCDASVLLEGPNSERTAPPNRLLHGFHVIDDAKNQLEAACPGIVSCADILTLAARDSVVLTNGPNWAVPTGRRDGTVSLASEALNLPGFTDSVDVQKQKFADKGLNTQDLVVLVGGHTIGTTSCQLFRDRLFNFNGTGTHDSTINRMFLPQLQILCPENGDGSMRVALDTGSVNRFDTSFFANLRDGKGVLQSDQALWSDASTRILV*HFLGVRGMFGSAFNIEFGRSMIKMSNIEVKTDTSGEIRRICSTI

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Stop in frame maybe due to bad sequencing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGTTCTGGTTTGTTAATTTTACTCTTTGTTTTGGCTGCCATGGCAGCAACTTCTGTCTATGGCCAAGGAACGAGAGTTGGTTACTACTATAAGACTTGTCCTCAAGCAGAG
TCCATTGTGAGGTCAACTGTGCAATCTCATTTTCGCTCAGATCCTACAATTGCTCCTGGCTTGTTGAGGATTCATTTTCATGATTGTTTTGTTCGTGGATGTGATGCTTCAGTTCTTCTC
GAAGGACCTAACTCCGAGAGAACAGCTCCTCCAAATCGATTATTGCATGGATTTCACGTTATCGACGATGCTAAAAATCAACTTGAAGCGGCATGTCCTGGAATTGTTTCATGTGCTGAT
ATTCTAACTCTTGCTGCCCGTGATTCCGTTGTCTTG
GTAACTTGCTAACTAATTATAATTATATTATATTTATCCTTATGTCAATTTATAGTTACATATAATTTATAAGATTTTTATTTT
ATTAAACTAATATAACATTTGTGTACACAGACCAATGGACCAAACTGGGCAGTGCCTACAGGACGTAGAGATGGAACAGTTTCATTGGCATCTGAAGCTCTGAATTTGCCTGGATTTACT
GATTCTGTTGATGTGCAAAAGCAAAAGTTTGCTGATAAGGGTCTCAATACCCAAGATCTTGTTGTTCTTGTTG
GTGAGCATCAATTAAAATTCTCTACTATAAAATAGTTAATTATAAGT
AATATTTTTAAATGGCGATGATTGTATAAATTTATTAATTATATGTATTTTTTGAATAACAGGTGGTCACACTATTGGTACTACATCATGTCAATTGTTTAGAGATAGATTATTCAATTT
CAACGGAACTGGAACACACGATTCTACTATTAATCGTATGTTTTTGCCTCAACTGCAAATTCTTTGTCCAGAAAATGGTGATGGATCAATGCGTGTTGCATTAGACACTGGTAGTGTAAA
TAGATTTGACACATCTTTCTTTGCAAATTTGAGAGATGGCAAAGGAGTTCTTCAATCTGATCAAGCGCTTTGGAGCGATGCTTCAACAAGAATTTTGGTTTAACATTTTTTGGGTGTTAG
AGGCATGTTCGGATCAGCCTTCAATATTGAATTTGGACGATCGATGATTAAAATGAGTAACATCGAAGTAAAAACTGATACTTCAGGTGAAATTCGCAGAATTTGTAGCACGATTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGTTCTGGTTTGTTAATTTTACTCTTTGTTTTGGCTGCCATGGCAGCAACTTCTGTCTATGGCCAAGGAACGAGAGTTGGTTACTACTATAAGACTTGTCCTCAAGCAGAG
TCCATTGTGAGGTCAACTGTGCAATCTCATTTTCGCTCAGATCCTACAATTGCTCCTGGCTTGTTGAGGATTCATTTTCATGATTGTTTTGTTCGTGGATGTGATGCTTCAGTTCTTCTC
GAAGGACCTAACTCCGAGAGAACAGCTCCTCCAAATCGATTATTGCATGGATTTCACGTTATCGACGATGCTAAAAATCAACTTGAAGCGGCATGTCCTGGAATTGTTTCATGTGCTGAT
ATTCTAACTCTTGCTGCCCGTGATTCCGTTGTCTTG
ACCAATGGACCAAACTGGGCAGTGCCTACAGGACGTAGAGATGGAACAGTTTCATTGGCATCTGAAGCTCTGAATTTGCCTGGA
TTTACTGATTCTGTTGATGTGCAAAAGCAAAAGTTTGCTGATAAGGGTCTCAATACCCAAGATCTTGTTGTTCTTGTTG
GTGGTCACACTATTGGTACTACATCATGTCAATTGTTTAGA
GATAGATTATTCAATTTCAACGGAACTGGAACACACGATTCTACTATTAATCGTATGTTTTTGCCTCAACTGCAAATTCTTTGTCCAGAAAATGGTGATGGATCAATGCGTGTTGCATTA
GACACTGGTAGTGTAAATAGATTTGACACATCTTTCTTTGCAAATTTGAGAGATGGCAAAGGAGTTCTTCAATCTGATCAAGCGCTTTGGAGCGATGCTTCAACAAGAATTTTGGTTTAA
CATTTTTTGGGTGTTAGAGGCATGTTCGGATCAGCCTTCAATATTGAATTTGGACGATCGATGATTAAAATGAGTAACATCGAAGTAAAAACTGATACTTCAGGTGAAATTCGCAGAATT
TGTAGCACGATTAAC

Retrieve as FASTA