Entry information : CpapPrx38 (CpPOD21 / evm.model.supercontig_468.4)
Entry ID 8766
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-11-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx38 (CpPOD21 / evm.model.supercontig_468.4)
Name (synonym) CpapPrx38 (CpPOD21 / evm.model.supercontig_468.4)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx38
start..stop
S start..stop
MePrx31 504 0 10..327 6..321
RcPrx54 499 7e-180 8..327 5..324
CsPrx44 497 3e-179 11..327 7..325
PalPrx08 496 8e-179 10..327 6..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16983..17381 399 N° 2 16685..16847 163 N° 3 16161..16582 422  
complement(join(16161..16582,16685..16847,16983..17381))


exon

Literature and cross-references CpapPrx38 (CpPOD21 / evm.model.supercontig_468.4)
DNA ref. Phytozome 12:   supercontig_468 (17381..16161)
Protein sequence: CpapPrx38 (CpPOD21 / evm.model.supercontig_468.4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (302)
PWM (Da):   %s   34921.89 (32307.6) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.33 (8.59) Peptide Signal:   %s   cut: 26 range:26-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEQTGVCFSMLLFVLVAMAATSVQGQGTRVGFYSRTCPRVESIVRSTVESHFRSDPTVAPGLLRMHFHDCFVNGCDASILIDGSNTEKTAVPNLQLKGFDVIDDVKSKLEAECPGIVSCADILALAARDSVVLTRGLTWTVPTGRRDGTVSLASDTANLPGFTDSVDVQKQKFTDKGLNTQDLVVLVGGHTIGTAGCAVIVNRLFNFNGTVGASDPSISPSFLPTLKALCPQNGNPGKRVALDTGSVSRFDTSFFTNLRDGKGVIQSDQVLWTDASTRTIAQRFLGIRGILGLTFNVEFGRSMIKMSNIRVKTGTQGEIRRVCTAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCAAACTGGTGTTTGTTTCTCGATGTTATTGTTTGTTTTGGTTGCCATGGCTGCCACTTCGGTGCAAGGCCAAGGCACACGTGTTGGGTTTTACTCTAGGACTTGCCCTCGAGTG
GAGTCGATTGTGAGATCAACTGTGGAGTCTCATTTTCGCTCTGATCCCACTGTCGCTCCTGGCTTACTAAGGATGCACTTTCATGATTGTTTTGTCAACGGATGTGATGCGTCAATTCTT
ATTGATGGGTCCAACACTGAGAAAACTGCAGTTCCTAACCTTCAATTAAAAGGATTTGATGTTATTGATGATGTTAAGTCCAAACTTGAAGCAGAATGTCCTGGAATTGTTTCATGTGCT
GATATTCTTGCCCTTGCTGCTCGGGACTCTGTGGTTCTG
GTAATAATTTACGAGAGTTTTCATCTAATATTTTTATTTTTATTTCATTATGTAGTTATATTGCTAAAATATGTATTCGTA
AGTAATCAAGCACATTAAAGTTCTTTTCGATTAACGTCACTTAAATATATGCAGACTAGAGGACTAACTTGGACAGTACCTACTGGACGAAGAGACGGAACAGTTTCTTTAGCATCCGAT
ACTGCTAACTTGCCTGGATTTACTGACTCTGTTGATGTGCAAAAACAAAAATTTACTGACAAAGGTCTCAACACCCAAGACCTTGTCGTCCTTGTCG
GTGAGTATTATTCTGAATAATTT
ATTTCTAATTTTTATGTTCTTCAATTATTGATTATATAACTTGAGATAACTATTTCTTACTATATTGTTTTGTAAACAGGTGGACACACAATTGGTACAGCAGGTTGTGCTGTAATTGTA
AACAGATTATTCAACTTTAATGGAACTGTTGGTGCATCAGATCCCTCAATAAGTCCTTCATTTCTTCCTACACTAAAAGCTCTCTGTCCTCAAAATGGTAATCCAGGAAAACGTGTTGCA
CTTGACACTGGTAGTGTAAGTAGATTTGATACATCATTCTTTACAAACTTAAGAGATGGCAAGGGAGTTATTCAATCCGATCAAGTACTTTGGACTGATGCCTCCACTAGAACTATTGCC
CAACGCTTTTTGGGTATTCGAGGTATTCTTGGATTAACGTTCAACGTTGAATTTGGTCGATCAATGATAAAAATGAGTAATATTAGAGTAAAAACAGGTACTCAAGGTGAAATTCGTCGA
GTATGCACTGCTATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCAAACTGGTGTTTGTTTCTCGATGTTATTGTTTGTTTTGGTTGCCATGGCTGCCACTTCGGTGCAAGGCCAAGGCACACGTGTTGGGTTTTACTCTAGGACTTGCCCTCGAGTG
GAGTCGATTGTGAGATCAACTGTGGAGTCTCATTTTCGCTCTGATCCCACTGTCGCTCCTGGCTTACTAAGGATGCACTTTCATGATTGTTTTGTCAACGGATGTGATGCGTCAATTCTT
ATTGATGGGTCCAACACTGAGAAAACTGCAGTTCCTAACCTTCAATTAAAAGGATTTGATGTTATTGATGATGTTAAGTCCAAACTTGAAGCAGAATGTCCTGGAATTGTTTCATGTGCT
GATATTCTTGCCCTTGCTGCTCGGGACTCTGTGGTTCTG
ACTAGAGGACTAACTTGGACAGTACCTACTGGACGAAGAGACGGAACAGTTTCTTTAGCATCCGATACTGCTAACTTGCCT
GGATTTACTGACTCTGTTGATGTGCAAAAACAAAAATTTACTGACAAAGGTCTCAACACCCAAGACCTTGTCGTCCTTGTCG
GTGGACACACAATTGGTACAGCAGGTTGTGCTGTAATT
GTAAACAGATTATTCAACTTTAATGGAACTGTTGGTGCATCAGATCCCTCAATAAGTCCTTCATTTCTTCCTACACTAAAAGCTCTCTGTCCTCAAAATGGTAATCCAGGAAAACGTGTT
GCACTTGACACTGGTAGTGTAAGTAGATTTGATACATCATTCTTTACAAACTTAAGAGATGGCAAGGGAGTTATTCAATCCGATCAAGTACTTTGGACTGATGCCTCCACTAGAACTATT
GCCCAACGCTTTTTGGGTATTCGAGGTATTCTTGGATTAACGTTCAACGTTGAATTTGGTCGATCAATGATAAAAATGAGTAATATTAGAGTAAAAACAGGTACTCAAGGTGAAATTCGT
CGAGTATGCACTGCTATTAATTAA

Retrieve as FASTA