Entry information : CpapPrx40 (CpPOD22 / evm.model.supercontig_49.84)
Entry ID 8768
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx40 (CpPOD22 / evm.model.supercontig_49.84)
Name (synonym) CpapPrx40 (CpPOD22 / evm.model.supercontig_49.84)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx40
start..stop
S start..stop
GrPrx33 461 8e-164 17..358 34..369
GhPrx33 459 4e-163 17..358 34..369
PtPrx67 451 8e-160 2..346 5..344
LuPrx03 448 7e-159 1..333 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 551765..552007 243 N° 2 551392..551589 198 N° 3 549843..550484 642  
complement(join(549843..550484,551392..551589,551765..552007))


exon

Literature and cross-references CpapPrx40 (CpPOD22 / evm.model.supercontig_49.84)
DNA ref. Phytozome 12:   supercontig_49 (552007..549843)
Protein sequence: CpapPrx40 (CpPOD22 / evm.model.supercontig_49.84)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (337)
PWM (Da):   %s   39358.13 (36906.8)  
PI (pH):   %s   6.98 (6.66) Peptide Signal:   %s   cut: 24 range:24-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASAAYLLLLASLLAAPFLCLSEVDLSSVPIKDGLSWTFYKQSCPKIESIIRKQLQKELKKDIGLAAALLRIHFHDCFVQGCDGSVLLSGSAGGPSDEQATPPNLSLRKEAFKVINDLSVRIQRQCGLVASCSDIAALAARDSVFLSGGPDYSIPLGRRDGTTFASFDATMASLPPPFAKTGRLIEMFAVFDLDTVDMVALSGGHTIGIGHCAGFVPRLFPTQDPTMDKTLAKKLRNICPTTNSTNFTDLDIRTPNIFDNKYYLDLMNRQGLFTSDQDLFIDQRTKGLVIEFAVNQNKFFEKFIIAMVKMSQISVLTRSQGQIRANCSLINSRYTGDDHLVSVVDAEKEEVAGSGWSRF*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCTGCTGCATATTTACTCTTGCTCGCATCTCTCTTAGCGGCTCCTTTCCTGTGTCTGTCCGAAGTGGACCTGTCCTCTGTGCCTATCAAGGATGGTCTTTCATGGACTTTC
TACAAGCAATCTTGTCCCAAAATTGAGTCCATTATCAGAAAACAGCTCCAGAAGGAGCTCAAGAAGGATATCGGCCTTGCTGCTGCCTTGCTCCGTATCCATTTCCATGACTGCTTCGTT
CAG
GTAACATTTCTTCTCTCACTCGTTTTCCTCCAACGCCCATTTAGCTTCACAGAAATTAATCACGACCCAGATAATTATATATGTCAATCGTTAAAGCTGATTAGCTGAATTTAACTC
ATGATCAAGAGCTTTATGATGACGAGCTTTATGAAGTGGTATACGTAAATATTTGCAGGGTTGCGATGGCTCGGTGTTGCTATCTGGATCGGCGGGCGGACCGAGCGACGAGCAGGCGAC
GCCGCCCAATTTGAGCTTGAGGAAGGAGGCGTTCAAGGTGATCAACGATCTTAGTGTGCGGATTCAGAGGCAGTGTGGGCTCGTTGCCTCTTGCTCCGACATCGCGGCTCTCGCTGCCCG
CGACTCTGTTTTCCTG
GTAATTAATTCACTTACTACCCATTCATCTCTTACTCCCTTCATAATATATGAAAAACAAAAAAAAAAATTATATAATTATATAATTATGTGATCAAACAAATA
AATTAAAGAAATTAACCAGGACTTTTTATTTTCTTCATTTGTGGAACCTCATACGTTGTCGTTTTGCAATAATAACTACTAAAAACAGTTTTAATTCATGTAAATATAGAATAATATCTA
TCCATCAAGTTGCTAAATTTATAGAATATTTGAAAACATTGTCAATCCAAAATAGGGCATATCGCAATCGAGGTGTGATTTTTGGCATCTAGCCACTCGTGGCCATTGATTTTGTCAATT
AATTAGGTAACAAATTTTTTACTGTATATTTGTTTGTGCTGTCGGTGGCCATATAATATATATATATATATATATATGTTCCTAAGTGTTTATTTGCATTTATCCTGTGACAGATATTTT
CTTGTACTGAATTTAAATCAAACTCGTGAATTTCAAGATAAAAACTTATGTTATTATTATTTTTATTTACTAAAAAATTTCACATATAATAAATAAACACGTTACTTTTAAATTTTTATT
GAAAAATGTGACAAAGGTACCATGGATCATTATTAAATAAATAATTGTAATTTAGATTTTATGCGTTCTTAAATAATTAAAAGGGAGGCTTGCTCTTGTCTATAATTTTATTTTTATTTT
TAATATAAGAGATTTGACTGGTTATCTCTAAACGCATGTGCATTAATTAAGACATCATATATATGTATATATGTAAAATGATACTTTTATTTTTGTTAAAGCTTATAAATATATTGTAAT
TCGTAAACAAGTTTAGGAGATTAAAATGATGATAATTAGTTAATATATGTATGTATATATATATATATGCATATGTTTTGCAGTCAGGAGGCCCTGATTATAGTATCCCACTGGGAAGGA
GAGATGGAACCACGTTCGCATCATTCGACGCAACAATGGCAAGCCTGCCGCCACCTTTCGCCAAAACGGGCCGACTGATAGAAATGTTCGCCGTCTTTGACCTGGACACCGTCGACATGG
TAGCCCTTTCCGGCGGCCACACCATCGGAATTGGCCACTGCGCCGGCTTCGTCCCTCGTCTATTCCCAACACAAGACCCCACCATGGACAAGACCTTAGCCAAAAAGCTCAGAAACATCT
GTCCCACAACCAACTCCACCAACTTCACTGACCTCGATATCCGCACCCCCAACATCTTCGACAACAAGTACTACCTCGACCTCATGAACCGCCAGGGACTCTTCACGTCCGACCAGGACT
TGTTCATTGACCAGAGGACCAAGGGTTTGGTGATCGAGTTCGCCGTCAACCAAAACAAGTTCTTTGAGAAGTTCATCATTGCCATGGTCAAGATGAGTCAAATTAGCGTCTTGACGAGGA
GCCAGGGGCAGATTCGGGCCAATTGTTCTCTTATCAATTCCCGCTACACTGGAGATGATCACTTGGTGTCTGTTGTGGATGCCGAGAAGGAGGAGGTGGCCGGTTCAGGTTGGTCCAGGT
TTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCTGCTGCATATTTACTCTTGCTCGCATCTCTCTTAGCGGCTCCTTTCCTGTGTCTGTCCGAAGTGGACCTGTCCTCTGTGCCTATCAAGGATGGTCTTTCATGGACTTTC
TACAAGCAATCTTGTCCCAAAATTGAGTCCATTATCAGAAAACAGCTCCAGAAGGAGCTCAAGAAGGATATCGGCCTTGCTGCTGCCTTGCTCCGTATCCATTTCCATGACTGCTTCGTT
CAG
GGTTGCGATGGCTCGGTGTTGCTATCTGGATCGGCGGGCGGACCGAGCGACGAGCAGGCGACGCCGCCCAATTTGAGCTTGAGGAAGGAGGCGTTCAAGGTGATCAACGATCTTAGT
GTGCGGATTCAGAGGCAGTGTGGGCTCGTTGCCTCTTGCTCCGACATCGCGGCTCTCGCTGCCCGCGACTCTGTTTTCCTG
TCAGGAGGCCCTGATTATAGTATCCCACTGGGAAGGAGA
GATGGAACCACGTTCGCATCATTCGACGCAACAATGGCAAGCCTGCCGCCACCTTTCGCCAAAACGGGCCGACTGATAGAAATGTTCGCCGTCTTTGACCTGGACACCGTCGACATGGTA
GCCCTTTCCGGCGGCCACACCATCGGAATTGGCCACTGCGCCGGCTTCGTCCCTCGTCTATTCCCAACACAAGACCCCACCATGGACAAGACCTTAGCCAAAAAGCTCAGAAACATCTGT
CCCACAACCAACTCCACCAACTTCACTGACCTCGATATCCGCACCCCCAACATCTTCGACAACAAGTACTACCTCGACCTCATGAACCGCCAGGGACTCTTCACGTCCGACCAGGACTTG
TTCATTGACCAGAGGACCAAGGGTTTGGTGATCGAGTTCGCCGTCAACCAAAACAAGTTCTTTGAGAAGTTCATCATTGCCATGGTCAAGATGAGTCAAATTAGCGTCTTGACGAGGAGC
CAGGGGCAGATTCGGGCCAATTGTTCTCTTATCAATTCCCGCTACACTGGAGATGATCACTTGGTGTCTGTTGTGGATGCCGAGAAGGAGGAGGTGGCCGGTTCAGGTTGGTCCAGGTTT
TAA

Retrieve as FASTA