Entry information : CpapPrx42 (CpPOD24 / evm.model.supercontig_53.11)
Entry ID 8770
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx42 (CpPOD24 / evm.model.supercontig_53.11)
Name (synonym) CpapPrx42 (CpPOD24 / evm.model.supercontig_53.11)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx42
start..stop
S start..stop
MePrx12 521 0 8..327 18..339
MtPrx40 518 0 5..327 7..337
CsaPrx77 515 0 2..327 9..340
MePrx128 514 0 16..327 28..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 62011..62220 210 N° 2 62322..62513 192 N° 3 62608..62773 166 N° 4 62922..63340 419
join(62011..62220,62322..62513,62608..62773,62922..63340)


exon

Literature and cross-references CpapPrx42 (CpPOD24 / evm.model.supercontig_53.11)
DNA ref. Phytozome 12:   supercontig_53 (62011..63340)
Protein sequence: CpapPrx42 (CpPOD24 / evm.model.supercontig_53.11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (308)
PWM (Da):   %s   36316.94 (33936.8)  
PI (pH):   %s   5.38 (5.15) Peptide Signal:   %s   cut: 24 range:21-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGICWKCVFVFVIFMTVFSACEPELTLDYYVKTCPAVLDIVRKEMECAVLSDPRNAALVVRLHFHDCFVQGCDGSILLDDTYTLRGEKKASTNIHSLKGFSIIDRIKNKLEYECPGIVSCADILTIAARDAVILVGGPYWDVPLGRKDSTTASYDLANSNLPTSDQPLLTIISKFLYQGLSVTDMVALSGAHTIGMARCENFRARIYGDFESTSDKLNPNSQTYASNLRSICPTAGGGDNNITAMDYVTPNLFDNSFYQILLRGEGLLNSDQAMYSSLLAMETKSLVTKYAHDSIAFFQQFSESMVKMGNITNQDTGQVRRNCRFINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAATTTGCTGGAAATGTGTGTTTGTGTTTGTGATTTTCATGACTGTATTTAGTGCATGTGAGCCTGAATTGACACTGGATTACTATGTAAAAACTTGCCCGGCTGTGCTTGACATT
GTGAGAAAAGAGATGGAATGTGCTGTGTTATCTGACCCTCGCAATGCAGCCTTGGTTGTTCGATTGCATTTCCATGACTGTTTTGTTCAG
GTCTCTCTCTATGTATATATACACACACAC
TCATACGTTTTTATAAAGAATACACAAATGTTTTAGGTTTTATATTTATATTTATTGGATTGGATAAACAGGGTTGTGATGGTTCAATTTTGCTTGATGACACGTACACACTGCGAGGAG
AAAAGAAAGCTTCTACCAATATTCACTCTTTAAAAGGTTTCAGCATTATAGATCGCATCAAGAACAAGCTTGAATATGAGTGTCCTGGTATTGTCTCTTGTGCAGATATCCTTACAATTG
CTGCTAGAGATGCTGTCATTCTG
GTAATATTAATCATTTTATTATATATATTATACCAAGAGCGAATTCAGTAGTTTATAGTTTAAATTAAATTATTTAATTGTTGCAATTATCAAGGTT
GGCGGACCATATTGGGATGTTCCATTGGGGAGGAAGGATTCTACAACAGCAAGCTATGATCTGGCTAACTCTAATCTTCCTACTTCCGATCAGCCTCTTCTCACCATCATTTCCAAGTTC
CTTTATCAAGGCCTTTCTGTAACTGACATGGTTGCTCTTTCCG
GTATATTCATCACCCTCATCTTAATCTACATATTTTGTTTCTAAGATTTTTGTCAACTCTGTAAGAAGGGTGTTATA
TCATCTGAAGTTAAAATGTTTTTAGTTTTAATCTGCATTCTTATAACAAAATGCATGTGTTAATTAATCAGGTGCCCACACAATTGGCATGGCTAGATGTGAGAATTTCCGGGCAAGGAT
TTACGGAGACTTTGAGTCCACATCCGACAAACTAAATCCGAACTCTCAAACATATGCAAGTAACCTGAGATCTATTTGCCCGACTGCTGGTGGCGGAGACAACAACATAACAGCAATGGA
TTACGTGACTCCGAATCTTTTTGATAACTCATTTTACCAAATTTTGTTGAGAGGAGAAGGGCTGCTGAACTCAGACCAGGCCATGTACTCGAGCCTCTTGGCAATGGAAACCAAGAGTCT
TGTCACTAAATACGCACACGATTCAATAGCTTTCTTTCAGCAATTCTCGGAGTCAATGGTTAAAATGGGAAACATCACTAATCAAGACACAGGACAAGTTAGGAGAAACTGCAGATTCAT
CAACGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAATTTGCTGGAAATGTGTGTTTGTGTTTGTGATTTTCATGACTGTATTTAGTGCATGTGAGCCTGAATTGACACTGGATTACTATGTAAAAACTTGCCCGGCTGTGCTTGACATT
GTGAGAAAAGAGATGGAATGTGCTGTGTTATCTGACCCTCGCAATGCAGCCTTGGTTGTTCGATTGCATTTCCATGACTGTTTTGTTCAG
GGTTGTGATGGTTCAATTTTGCTTGATGAC
ACGTACACACTGCGAGGAGAAAAGAAAGCTTCTACCAATATTCACTCTTTAAAAGGTTTCAGCATTATAGATCGCATCAAGAACAAGCTTGAATATGAGTGTCCTGGTATTGTCTCTTGT
GCAGATATCCTTACAATTGCTGCTAGAGATGCTGTCATTCTG
GTTGGCGGACCATATTGGGATGTTCCATTGGGGAGGAAGGATTCTACAACAGCAAGCTATGATCTGGCTAACTCTAAT
CTTCCTACTTCCGATCAGCCTCTTCTCACCATCATTTCCAAGTTCCTTTATCAAGGCCTTTCTGTAACTGACATGGTTGCTCTTTCCG
GTGCCCACACAATTGGCATGGCTAGATGTGAG
AATTTCCGGGCAAGGATTTACGGAGACTTTGAGTCCACATCCGACAAACTAAATCCGAACTCTCAAACATATGCAAGTAACCTGAGATCTATTTGCCCGACTGCTGGTGGCGGAGACAAC
AACATAACAGCAATGGATTACGTGACTCCGAATCTTTTTGATAACTCATTTTACCAAATTTTGTTGAGAGGAGAAGGGCTGCTGAACTCAGACCAGGCCATGTACTCGAGCCTCTTGGCA
ATGGAAACCAAGAGTCTTGTCACTAAATACGCACACGATTCAATAGCTTTCTTTCAGCAATTCTCGGAGTCAATGGTTAAAATGGGAAACATCACTAATCAAGACACAGGACAAGTTAGG
AGAAACTGCAGATTCATCAACGCATGA

Retrieve as FASTA