Entry information : CpapPrx44 (CpPOD26 / evm.model.supercontig_6.180)
Entry ID 8772
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-04-07 (Christophe Dunand)
Peroxidase information: CpapPrx44 (CpPOD26 / evm.model.supercontig_6.180)
Name (synonym) CpapPrx44 (CpPOD26 / evm.model.supercontig_6.180)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx44
start..stop
S start..stop
RcPrx17 588 0 1..331 1..331
CclPrx35 588 0 1..330 1..330
LcPrx03 586 0 1..331 1..332
CsPrx10 585 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1468880..1469104 225 N° 2 1469183..1469374 192 N° 3 1469488..1469653 166 N° 4 1469738..1470150 413
join(1468880..1469104,1469183..1469374,1469488..1469653,1469738..1470150)


exon

Literature and cross-references CpapPrx44 (CpPOD26 / evm.model.supercontig_6.180)
Literature Paull RE, Iret al., (2008) Fruit development, ripening and quality related genes in the papaya genome. Trop Plant Biol 1:246–277
DNA ref. Phytozome 11:   supercontig_6 (1468880..1470150)
Protein sequence: CpapPrx44 (CpPOD26 / evm.model.supercontig_6.180)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (309)
PWM (Da):   %s   36699.83 (34128.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.66 (9.54) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSKNFLLLISLLAFFPLCFSSKTIGGYLYPQFYDHSCPKAQEIVKSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASVLLDGSGSIITEKISNPNRNSARGFEVLDEIKDALEKECPHTVSCADILTLAARHSTVLTGGPSWEVPLGRRDSRGASLSGSNNDIPAPNNTFETILTKFKRQGLNIVDLVALSGSHTIGNARCTSFRQRLYNQTGNGRPDYTIDQSFAAQLRRRCPRSGGDQNLFFLDFVSPTKFDNSYFKNLLAYKGLLNSDQVLLTKNQQAMELVKQYAENQELFFVQFAKSMIKMGNISPLTGSRGEIRKNCRKINS

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGTCTAAGAACTTTCTTCTACTCATTTCTCTTCTTGCATTTTTCCCACTTTGCTTCTCTAGTAAGACCATTGGGGGCTACCTTTATCCTCAGTTTTATGACCATTCATGCCCA
AAAGCTCAGGAGATTGTCAAGTCCATAGTAGCCAAAGCTGTCGCGAAAGAAGCTCGCATGGCAGCTTCGTTACTCAGGCTACATTTCCATGACTGTTTTGTTAAG
GTCCGGTTTCCTAAT
CCCTCGTGAGATATTTGTAGTTTACTTCTGCAGTTTCATTGAACCATGTTGTTAATCCTGCAGGGCTGTGATGCGTCGGTGTTGTTAGACGGTAGTGGCAGCATAATCACTGAGAAAATC
TCAAACCCAAATCGGAATTCTGCTCGTGGATTTGAAGTTCTTGACGAGATCAAGGATGCTCTAGAGAAGGAGTGTCCTCATACTGTATCTTGTGCTGACATTTTGACTTTAGCTGCTAGA
CATTCTACAGTTCTT
GTAAGTGTTGGATTTTCTTTTTGCAGTCTTGTAGGCATGATTTCTTGTTTTTGTCGATTAATGTAGGTCTTGTCTAAAGTTCCCATGGCTGATTATCTTTGTTGT
GTCGGCAGACTGGTGGACCTAGCTGGGAAGTCCCATTAGGAAGAAGGGACTCGAGAGGTGCAAGCTTGAGTGGCTCCAACAATGATATTCCTGCTCCAAACAACACCTTTGAAACCATTC
TAACCAAGTTCAAGCGTCAAGGACTTAACATTGTTGATCTTGTTGCTCTTTCTG
GTAACTCAAATGAATTAAATTGATTTAAAGTGTGTCTGGAAACCTATTATACTTAAAGCCATGGCT
AAAAATTTCTAAATTTAGGGAGTCACACAATCGGAAATGCTAGATGCACCAGCTTCAGGCAGAGGCTCTACAACCAAACAGGCAATGGAAGACCTGACTACACGATTGACCAATCATTTG
CTGCTCAGTTGCGTCGGCGTTGCCCAAGATCCGGAGGTGACCAGAACCTGTTCTTCTTGGATTTCGTTAGCCCAACAAAGTTTGACAACAGCTACTTCAAGAACTTGCTGGCTTATAAGG
GACTGTTGAACTCTGATCAAGTTCTGTTGACAAAGAACCAGCAAGCTATGGAGTTAGTGAAGCAATATGCTGAAAACCAGGAGCTTTTCTTCGTGCAATTTGCCAAGTCTATGATTAAGA
TGGGAAATATCTCTCCATTGACAGGCTCAAGAGGAGAGATCAGAAAGAACTGCAGGAAGATAAACTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGTCTAAGAACTTTCTTCTACTCATTTCTCTTCTTGCATTTTTCCCACTTTGCTTCTCTAGTAAGACCATTGGGGGCTACCTTTATCCTCAGTTTTATGACCATTCATGCCCA
AAAGCTCAGGAGATTGTCAAGTCCATAGTAGCCAAAGCTGTCGCGAAAGAAGCTCGCATGGCAGCTTCGTTACTCAGGCTACATTTCCATGACTGTTTTGTTAAG
GGCTGTGATGCGTCG
GTGTTGTTAGACGGTAGTGGCAGCATAATCACTGAGAAAATCTCAAACCCAAATCGGAATTCTGCTCGTGGATTTGAAGTTCTTGACGAGATCAAGGATGCTCTAGAGAAGGAGTGTCCT
CATACTGTATCTTGTGCTGACATTTTGACTTTAGCTGCTAGACATTCTACAGTTCTT
ACTGGTGGACCTAGCTGGGAAGTCCCATTAGGAAGAAGGGACTCGAGAGGTGCAAGCTTGAGT
GGCTCCAACAATGATATTCCTGCTCCAAACAACACCTTTGAAACCATTCTAACCAAGTTCAAGCGTCAAGGACTTAACATTGTTGATCTTGTTGCTCTTTCTG
GGAGTCACACAATCGGA
AATGCTAGATGCACCAGCTTCAGGCAGAGGCTCTACAACCAAACAGGCAATGGAAGACCTGACTACACGATTGACCAATCATTTGCTGCTCAGTTGCGTCGGCGTTGCCCAAGATCCGGA
GGTGACCAGAACCTGTTCTTCTTGGATTTCGTTAGCCCAACAAAGTTTGACAACAGCTACTTCAAGAACTTGCTGGCTTATAAGGGACTGTTGAACTCTGATCAAGTTCTGTTGACAAAG
AACCAGCAAGCTATGGAGTTAGTGAAGCAATATGCTGAAAACCAGGAGCTTTTCTTCGTGCAATTTGCCAAGTCTATGATTAAGATGGGAAATATCTCTCCATTGACAGGCTCAAGAGGA
GAGATCAGAAAGAACTGCAGGAAGATAAACTCTTAA

Retrieve as FASTA