Entry information : CpapPrx47 (evm.model.supercontig_6.303)
Entry ID 8774
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapPrx47 (evm.model.supercontig_6.303)
Name (synonym) CpapPrx47 (evm.model.supercontig_6.303)
Class Class III peroxidase     [Orthogroup: Prx016]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx47
start..stop
S start..stop
RcPrx13 472 4e-170 1..293 25..317
MePrx121 468 3e-168 1..293 26..318
LePrx03 465 4e-167 1..293 25..317
PtPrx44 463 2e-166 1..293 25..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2247655..2247789 135 N° 2 2247367..2247555 189 N° 3 2247127..2247289 163 N° 4 2246622..2247016 395
complement(join(2246622..2247016,2247127..2247289,2247367..2247555,2247655..2247 789))


exon

Literature and cross-references CpapPrx47 (evm.model.supercontig_6.303)
DNA ref. Phytozome 11:   supercontig_6 (2247789..2246622)
Protein sequence: CpapPrx47 (evm.model.supercontig_6.303)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   293
PWM (Da):   %s   32243.62  
PI (pH):   %s   9.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SLNYYEKTCPYADDIVNDIVKKAVAKDKTVPAALLRMHFHDCFIRGCDGSILLNSGGGNKAEKDAPPNGSLHAFYVIDVAKRVVEDRCPGVVSCADILALAARDAVVLSGGPTWSVEKGRRDGRISRASETTTLPTPTFNISQLQKNFYLRGLYLKDLVALLGAHTLGFSHCSSFGNRIYNFNTTHDIDPVMRPSFATRLRTICPPNNKVKNAGATMDPSPTTFDNTYYKLVLQRKALFSSDQALLTTPFTKSLVYKFATSKKAFHQAFVKSIIKMSSLNGGQEVRKDCKVIN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing due to the NNNNNN in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCTTGAATTACTACGAGAAAACGTGCCCATACGCTGATGATATTGTGAATGACATCGTGAAGAAGGCAGTGGCCAAAGACAAAACAGTTCCTGCTGCTCTACTCAGAATGCATTTTCAC
GACTGCTTCATAAGG
GTAATTCGTTGCCATTTTATTAGGTCTTCTCTTTTTGTGTTTTTTTTTTCTTTTCTACAATGCGAAATAGTTTTATATGTGTTTATTGATTTGGTGAAGGGTTGT
GATGGGTCGATATTGTTAAACTCTGGAGGAGGCAACAAAGCAGAGAAAGATGCACCGCCGAATGGTTCCCTACATGCATTTTATGTTATTGATGTTGCAAAGAGGGTAGTAGAAGACAGG
TGTCCTGGAGTTGTCTCCTGCGCAGATATTCTGGCTTTGGCTGCCAGAGATGCTGTTGTGCTT
GTAAGACATAATACCTACTTGTATATATTAACATTATGAGCAACATTTTACAATATA
CAATGCTAATTAATTTACAGTCTGGAGGTCCAACATGGAGTGTGGAAAAAGGGAGAAGAGATGGAAGAATATCAAGAGCAAGTGAAACTACAACGTTGCCAACTCCAACATTCAACATAT
CTCAATTGCAGAAGAACTTTTATCTAAGAGGTCTCTATTTGAAGGACTTGGTAGCTCTTTTAG
GTATACTTTTACTCTTTTAACATACAATTTTTTTTAGGTATGTGACTCCAATAACTA
TATATAAGTGTGTGTGTGTGTGTATATGTAACAATTGAGATAAATATGTGCAGGAGCACACACACTAGGATTTTCTCATTGTTCGTCATTCGGAAATAGAATCTACAACTTCAATACCAC
TCATGACATAGACCCCGTAATGCGCCCTTCCTTTGCAACAAGACTAAGGACCATCTGTCCACCTAACAACAAGGTCAAGAATGCTGGAGCTACAATGGATCCTTCACCGACAACTTTTGA
CAACACATATTACAAGCTGGTTCTACAGAGAAAAGCACTTTTCTCCTCAGATCAAGCCCTGCTCACTACTCCTTTCACCAAGTCTTTGGTCTATAAATTTGCTACCTCAAAAAAAGCTTT
TCACCAGGCTTTTGTCAAATCGATTATCAAAATGAGTAGCCTCAATGGAGGACAGGAGGTTAGAAAAGATTGTAAGGTGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCTTGAATTACTACGAGAAAACGTGCCCATACGCTGATGATATTGTGAATGACATCGTGAAGAAGGCAGTGGCCAAAGACAAAACAGTTCCTGCTGCTCTACTCAGAATGCATTTTCAC
GACTGCTTCATAAGG
GGTTGTGATGGGTCGATATTGTTAAACTCTGGAGGAGGCAACAAAGCAGAGAAAGATGCACCGCCGAATGGTTCCCTACATGCATTTTATGTTATTGATGTTGCA
AAGAGGGTAGTAGAAGACAGGTGTCCTGGAGTTGTCTCCTGCGCAGATATTCTGGCTTTGGCTGCCAGAGATGCTGTTGTGCTT
TCTGGAGGTCCAACATGGAGTGTGGAAAAAGGGAGA
AGAGATGGAAGAATATCAAGAGCAAGTGAAACTACAACGTTGCCAACTCCAACATTCAACATATCTCAATTGCAGAAGAACTTTTATCTAAGAGGTCTCTATTTGAAGGACTTGGTAGCT
CTTTTAG
GAGCACACACACTAGGATTTTCTCATTGTTCGTCATTCGGAAATAGAATCTACAACTTCAATACCACTCATGACATAGACCCCGTAATGCGCCCTTCCTTTGCAACAAGACTA
AGGACCATCTGTCCACCTAACAACAAGGTCAAGAATGCTGGAGCTACAATGGATCCTTCACCGACAACTTTTGACAACACATATTACAAGCTGGTTCTACAGAGAAAAGCACTTTTCTCC
TCAGATCAAGCCCTGCTCACTACTCCTTTCACCAAGTCTTTGGTCTATAAATTTGCTACCTCAAAAAAAGCTTTTCACCAGGCTTTTGTCAAATCGATTATCAAAATGAGTAGCCTCAAT
GGAGGACAGGAGGTTAGAAAAGATTGTAAGGTGATCAATTAA

Retrieve as FASTA