Entry information : CpapPrx48 (evm.model.supercontig_6.388)
Entry ID 8775
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapPrx48 (evm.model.supercontig_6.388)
Name (synonym) CpapPrx48 (evm.model.supercontig_6.388)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx48
start..stop
S start..stop
CclPrx59 489 1e-175 6..334 2..329
CsPrx09 487 2e-175 24..334 1..310
PpePrx13 483 2e-173 17..334 7..324
NtPrx31-1A 476 8e-171 20..334 13..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2946541..2946777 237 N° 2 2946249..2946440 192 N° 3 2945574..2946152 579  
complement(join(2945574..2946152,2946249..2946440,2946541..2946777))


exon

Literature and cross-references CpapPrx48 (evm.model.supercontig_6.388)
DNA ref. Phytozome 12:   supercontig_6 (2946777..2945574)
Protein sequence: CpapPrx48 (evm.model.supercontig_6.388)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (303)
PWM (Da):   %s   36596.12 (32696.1) Transmb domain:   %s   i20-42o
PI (pH):   %s   6.35 (5.12) Peptide Signal:   %s   cut: 33 range:33-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGHRCHDEKPSFNLRKLIQLFFFLMLSPLALCQLSYKFYDYTCPNLTRIVRYGVMSALANDSRMAASLLRLHFHDCFVNGCDASVLLDDTSSMEGEKGAAPNRNSVRGFEVIDAIKASLEKACPYTVSCADIISLASRDAVYLAGGPCWSVPLGRRDGLTANKDGANDDIPSPFESLQNITAKFTAKGLDIKDVVVLSGGHSIGFAQCFTFKQRLFDFGGSGIADPALDTSLLQSLQKTCPDQDDSDTTLAPLDPVTTNKFDNVYYKNLVSGTGLLQSDQDLMGDNQTAAMVVTYSKYPLLFFRDFGASMVKMSNIGALTGKDGQIRRNCRVVNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCACCGTTGTCATGATGAAAAACCCTCGTTTAACCTTAGAAAACTTATTCAGTTGTTCTTCTTCTTGATGTTAAGTCCTCTGGCTCTGTGTCAACTGAGCTATAAATTCTACGAC
TATACTTGCCCTAATCTTACCAGAATTGTTCGCTATGGTGTTATGTCAGCTCTTGCTAATGACTCTCGCATGGCTGCCTCTCTCTTGCGCCTTCACTTCCACGACTGTTTCGTTAAT
GTA
ATTTCATTTGACTTTTCATAATACTGAAGTTGTTAAGTTGATGAATACATATATCACATACTCTATATATACTATATATGTGTATGTATATATGCAGGGATGTGATGCTTCAGTTTTACT
GGACGATACGAGCAGCATGGAAGGGGAGAAAGGTGCAGCTCCAAACAGGAACTCAGTGAGAGGTTTTGAGGTCATTGACGCCATTAAAGCTAGCTTGGAGAAGGCTTGTCCTTATACTGT
TTCTTGCGCTGATATCATAAGTCTTGCTTCAAGAGACGCTGTCTATTTG
GTATATTTATATATGACAAAATATATATACACTATTACATAAATACATACATATGTACGTGTAACCTTGTG
GTCATTAAAATGATTTACATGTTAGGCTGGAGGTCCATGTTGGTCAGTCCCATTAGGCCGGCGAGATGGCTTGACAGCAAACAAAGATGGAGCAAACGACGATATCCCATCACCTTTCGA
ATCATTACAGAACATCACTGCAAAATTCACTGCTAAAGGCCTCGACATTAAAGATGTGGTGGTCCTTTCAGGAGGACACAGCATTGGTTTTGCTCAATGCTTCACATTCAAGCAAAGGCT
TTTCGACTTCGGCGGCTCCGGCATTGCAGACCCTGCACTTGACACGTCCCTGCTGCAGAGTTTACAGAAAACGTGTCCCGATCAAGATGATTCTGACACTACTTTGGCTCCTCTAGATCC
TGTCACCACCAACAAGTTTGACAATGTTTACTACAAAAATCTTGTGAGTGGCACGGGCCTGCTACAGTCTGACCAAGATTTGATGGGAGATAATCAGACAGCTGCAATGGTTGTCACCTA
CAGCAAGTACCCTTTACTGTTCTTCAGGGATTTTGGAGCGTCCATGGTGAAGATGTCCAATATAGGTGCATTGACTGGAAAAGACGGGCAGATAAGGAGGAACTGTAGAGTGGTGAACAA
TTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCACCGTTGTCATGATGAAAAACCCTCGTTTAACCTTAGAAAACTTATTCAGTTGTTCTTCTTCTTGATGTTAAGTCCTCTGGCTCTGTGTCAACTGAGCTATAAATTCTACGAC
TATACTTGCCCTAATCTTACCAGAATTGTTCGCTATGGTGTTATGTCAGCTCTTGCTAATGACTCTCGCATGGCTGCCTCTCTCTTGCGCCTTCACTTCCACGACTGTTTCGTTAAT
GGA
TGTGATGCTTCAGTTTTACTGGACGATACGAGCAGCATGGAAGGGGAGAAAGGTGCAGCTCCAAACAGGAACTCAGTGAGAGGTTTTGAGGTCATTGACGCCATTAAAGCTAGCTTGGAG
AAGGCTTGTCCTTATACTGTTTCTTGCGCTGATATCATAAGTCTTGCTTCAAGAGACGCTGTCTATTTG
GCTGGAGGTCCATGTTGGTCAGTCCCATTAGGCCGGCGAGATGGCTTGACA
GCAAACAAAGATGGAGCAAACGACGATATCCCATCACCTTTCGAATCATTACAGAACATCACTGCAAAATTCACTGCTAAAGGCCTCGACATTAAAGATGTGGTGGTCCTTTCAGGAGGA
CACAGCATTGGTTTTGCTCAATGCTTCACATTCAAGCAAAGGCTTTTCGACTTCGGCGGCTCCGGCATTGCAGACCCTGCACTTGACACGTCCCTGCTGCAGAGTTTACAGAAAACGTGT
CCCGATCAAGATGATTCTGACACTACTTTGGCTCCTCTAGATCCTGTCACCACCAACAAGTTTGACAATGTTTACTACAAAAATCTTGTGAGTGGCACGGGCCTGCTACAGTCTGACCAA
GATTTGATGGGAGATAATCAGACAGCTGCAATGGTTGTCACCTACAGCAAGTACCCTTTACTGTTCTTCAGGGATTTTGGAGCGTCCATGGTGAAGATGTCCAATATAGGTGCATTGACT
GGAAAAGACGGGCAGATAAGGAGGAACTGTAGAGTGGTGAACAATTAA

Retrieve as FASTA