Entry information : CpapPrx51 (CpPOD28 / evm.model.supercontig_6.431)
Entry ID 8776
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx51 (CpPOD28 / evm.model.supercontig_6.431)
Name (synonym) CpapPrx51 (CpPOD28 / evm.model.supercontig_6.431)
Class Class III peroxidase    [Orthogroup: Prx050]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx51
start..stop
S start..stop
PpePrx23 501 2e-180 1..334 1..332
CsaPrx88 486 2e-174 9..335 7..332
CagraPrx24 483 4e-173 11..334 13..336
VvPrx15 482 6e-173 1..334 4..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3323848..3324069 222 N° 2 3324182..3324373 192 N° 3 3324468..3324633 166 N° 4 3324732..3325162 431
join(3323848..3324069,3324182..3324373,3324468..3324633,3324732..3325162)


exon

Literature and cross-references CpapPrx51 (CpPOD28 / evm.model.supercontig_6.431)
DNA ref. Phytozome 11:   supercontig_6 (3323848..3325162)
Protein sequence: CpapPrx51 (CpPOD28 / evm.model.supercontig_6.431)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (314)
PWM (Da):   %s   37595.18 (34927.8)  
PI (pH):   %s   5.93 (5.43) Peptide Signal:   %s   cut: 23 range:23-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRLIEVAVVLTMLMMMKSSLATSDEGLLQLDFYKETCPLAEEIIGRMVEIAVLKDPRMAASLLRLHFHDCFVLGCDASVLLDSHGDMISEKEAGPNLNSIRGFLVIDEIKSLLEEACPLTVSCADILAIVARDAVYTRGGPRWMVWLGRRDSLKASFDGANQFIPAPNSSLLGLISNFKQQGLDIQDLVALSGSHTIGKARCLSFKERIDQVNPIEVHSYDKYKRYNTFRKTLRSTCSDSGRDSELAPLDLKTPSRFDNHYYINLLEGKGLLGSDNVLVSEDEEGEIIKQVWSYASNQDLFFDSFVKSIVKMGNINVLTGHQGEIRKNCRLINNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Extra 5' end has been removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACGGTTGATTGAGGTAGCAGTTGTTTTGACGATGCTGATGATGATGAAGAGTTCATTGGCGACGAGTGATGAAGGACTTCTTCAGCTTGATTTTTACAAAGAAACATGCCCTTTA
GCAGAAGAAATCATCGGACGAATGGTGGAGATTGCAGTGCTCAAGGATCCTCGAATGGCTGCCTCGCTCCTCAGATTACATTTTCATGACTGTTTTGTCTTG
GTAATCAATTACCCCTTT
CTATCTCTCCAATGTAACACATTTGATGTATACCCACTTCATATATGATATGTATTTTGTATGAATGATGAAGAAAACATACACTACTGATCAGGGATGTGATGCATCAGTCCTACTGGA
TAGCCATGGAGACATGATCAGTGAAAAGGAAGCAGGGCCTAATCTCAATTCTATACGCGGATTTCTAGTTATAGATGAGATCAAATCTCTTTTGGAAGAAGCTTGTCCCCTTACAGTCTC
GTGTGCTGACATCTTGGCCATTGTCGCCCGGGATGCTGTTTACACG
GTATATTAGTATATATATACTTATGGTACTACACACGTATATCATTGTTACTAATTTCATTTTGATATATATGT
ATGCATGTGTACATATGAAGAGAGGGGGCCCAAGGTGGATGGTTTGGCTTGGAAGGAGAGACTCACTAAAAGCAAGTTTTGATGGAGCCAACCAATTCATTCCTGCTCCAAACTCCTCCC
TCCTGGGTCTCATTTCCAATTTCAAGCAACAGGGTCTTGATATCCAAGATCTCGTTGCTTTATCAG
GTACTTATAAATATACATGAATGTATACATATCATTTTTCTAATATGTAAAAAT
TGTAGGTGAAGTAAAAAAACAATTAATGGTATGCACAAATGCAGGGAGCCACACAATAGGAAAAGCAAGATGTTTGAGCTTCAAAGAAAGGATAGACCAAGTGAATCCCATAGAAGTACA
CAGTTATGATAAATACAAAAGATATAATACATTTAGAAAGACCTTACGGTCCACATGCTCCGATTCAGGAAGAGACAGTGAATTGGCGCCGCTTGATTTGAAGACCCCCTCAAGGTTTGA
CAACCATTACTACATCAACTTGCTTGAAGGAAAAGGGTTACTGGGGTCGGATAATGTGTTGGTAAGTGAAGATGAAGAAGGAGAAATAATAAAGCAAGTGTGGAGCTATGCTTCCAATCA
AGACCTCTTCTTTGATTCATTTGTGAAATCTATAGTGAAGATGGGTAACATTAATGTGCTTACAGGACATCAAGGAGAGATTAGAAAGAATTGTAGGTTAATCAACAATTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACGGTTGATTGAGGTAGCAGTTGTTTTGACGATGCTGATGATGATGAAGAGTTCATTGGCGACGAGTGATGAAGGACTTCTTCAGCTTGATTTTTACAAAGAAACATGCCCTTTA
GCAGAAGAAATCATCGGACGAATGGTGGAGATTGCAGTGCTCAAGGATCCTCGAATGGCTGCCTCGCTCCTCAGATTACATTTTCATGACTGTTTTGTCTTG
GGATGTGATGCATCAGTC
CTACTGGATAGCCATGGAGACATGATCAGTGAAAAGGAAGCAGGGCCTAATCTCAATTCTATACGCGGATTTCTAGTTATAGATGAGATCAAATCTCTTTTGGAAGAAGCTTGTCCCCTT
ACAGTCTCGTGTGCTGACATCTTGGCCATTGTCGCCCGGGATGCTGTTTACACG
AGAGGGGGCCCAAGGTGGATGGTTTGGCTTGGAAGGAGAGACTCACTAAAAGCAAGTTTTGATGGA
GCCAACCAATTCATTCCTGCTCCAAACTCCTCCCTCCTGGGTCTCATTTCCAATTTCAAGCAACAGGGTCTTGATATCCAAGATCTCGTTGCTTTATCAG
GGAGCCACACAATAGGAAAA
GCAAGATGTTTGAGCTTCAAAGAAAGGATAGACCAAGTGAATCCCATAGAAGTACACAGTTATGATAAATACAAAAGATATAATACATTTAGAAAGACCTTACGGTCCACATGCTCCGAT
TCAGGAAGAGACAGTGAATTGGCGCCGCTTGATTTGAAGACCCCCTCAAGGTTTGACAACCATTACTACATCAACTTGCTTGAAGGAAAAGGGTTACTGGGGTCGGATAATGTGTTGGTA
AGTGAAGATGAAGAAGGAGAAATAATAAAGCAAGTGTGGAGCTATGCTTCCAATCAAGACCTCTTCTTTGATTCATTTGTGAAATCTATAGTGAAGATGGGTAACATTAATGTGCTTACA
GGACATCAAGGAGAGATTAGAAAGAATTGTAGGTTAATCAACAATTACTAA

Retrieve as FASTA