Entry information : CpapPrx52 (CpPOD27 / evm.model.supercontig_6.43)
Entry ID 8777
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx52 (CpPOD27 / evm.model.supercontig_6.43)
Name (synonym) CpapPrx52 (CpPOD27 / evm.model.supercontig_6.43)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx52
start..stop
S start..stop
RcPrx21 549 0 19..325 28..334
VvPrx04 540 0 11..325 6..321
EgrPrx134 540 0 6..325 10..329
EglPrx134 540 0 6..325 10..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 272574..272777 204 N° 2 272056..272256 201 N° 3 271727..271892 166 N° 4 270792..271198 407
complement(join(270792..271198,271727..271892,272056..272256,272574..272777))


exon

Literature and cross-references CpapPrx52 (CpPOD27 / evm.model.supercontig_6.43)
DNA ref. Phytozome 12:   supercontig_6 (272777..270792)
Protein sequence: CpapPrx52 (CpPOD27 / evm.model.supercontig_6.43)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (305)
PWM (Da):   %s   35020.87 (32753.7)  
PI (pH):   %s   9.59 (9.61) Peptide Signal:   %s   cut: 21 range:21-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRFSWVVVVLSLCLYAASAQVLKQNFYANVCPNVESIVRGVVRQKFQQTFVTVPATLRLFFHDCVVQGCDASVIVASTGSNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPSCRNKVSCADILAMATRDVIALAGGPSYAVELGRLDGLSSTAKSVNGKLPQPNFNLNQLNSLFAAIGLTQTDMIALSAAHTLGFSHCNKFANRIYNFSRQNPVDPTLNKAYAAQLQAMCPKKVDPRIAINMDPNTPRTFDNAYYKNLVEGKGLFTSDQILFTDPRSKSTVMAWAGNKAAFEKAFIAAMTKLGRVGVKTGTNGNIRRNCAAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTTCAGTTGGGTGGTAGTGGTGTTGTCACTTTGTCTTTACGCTGCATCGGCTCAGGTGCTTAAACAGAACTTTTACGCTAATGTCTGTCCCAACGTTGAATCCATTGTAAGA
GGCGTCGTCCGACAGAAGTTCCAACAGACCTTCGTCACTGTCCCCGCCACTCTCCGGCTTTTCTTCCATGATTGCGTTGTTCAG
GTATATTTACATATACATACATACATACATATATAT
ATATATATTGAAGAACAATTCTCACCATATCCTTCATTCCGTATATTTCGAAAATATTGAATTCAACAGGACTTACCCTCGGGTTTAGTTGTTATTATATAATTTATTATATATCCCAAT
TACACTTAAGTCTCTTTCTGATTTCGGCGATAGAGCAGTACTACTAAATTATTTGGTGATTGACTTATTGGGTTTGATTTATTTACTGTTCGTTGATTAAGTTAAGGATTTTGTAAACTA
ATGTACTGACTCTGGAGTTGGAAATAATGAAAATGTGCAAGGGGTGCGATGCTTCGGTAATTGTTGCATCGACGGGAAGCAACACGGCGGAGAAAGACCACCCGGATAATTTATCGTTGG
CCGGAGATGGATTCGATACCGTGATTAAAGCCAAAGCTGCTGTAGATGCAATCCCTAGTTGCAGAAACAAGGTCTCTTGTGCTGACATTCTCGCCATGGCCACCCGAGATGTCATTGCTT
TG
GTTCGCACACTTTACTTTCTCTTCCCTGTTATTATTTAAGAACTTCTGAATAATTTTTTTTTAATAAATGGACCTGGGTACCTATTTAAAAAAAAAAAAAACTCATAATTTTGTTTAA
ATTAAAAAATTTGTGGGTTTTGAAATATATAAATAAAAATTGCAGGCTGGTGGACCGTCGTATGCGGTTGAGCTGGGAAGACTTGACGGGCTAAGCTCAACGGCTAAAAGTGTAAATGGG
AAATTGCCGCAGCCTAACTTCAATCTCAACCAGCTCAATTCTCTCTTTGCTGCTATTGGCCTTACCCAAACTGACATGATTGCCCTCTCCG
GTACGCCTCCTCTAAAATCTAAGAACTGT
TTAAATAAAATATGCAAATAATTTTTAAAATAAATTTCTTTTCTTTTTACTTCGTATTTAACTTTAAAACGAATTATTTTGTGTAAATCATAACATAAACAAAAAGATTTTCCTACTAAT
TGTGATTTTTTAGTATTTAATAATTAATGTTGAAAAAGGTATCATTTAAAATGTTACCGCTTCCAGGTCAGATTAATCTGTCTCGTGGTTGGGCATCTTGGTTCCTGTATGATTGTGTTT
GAGTGGGTCCCAACCGAGGAGACCTGTCCTGTTGTCTTATGATTAGGATTTGACGAATTTACCCTCTACGAGTTGGCACTGACACCACTGCGCATGATTTGATTAATTGAAAAAGAAAAT
GTAATTTTAAGAATGTTTTTTTTTTTTGTGTTAATTCTCACGTGCGTAAATCGGTCAAGAATAAGAAAAAATAGGAACCGTCTGATCAGATTAATTATCGAGGTGAAGTTTTGACTTTGA
TTTTTTTTATTTCCTGCAGCCGCCCACACCCTTGGGTTCTCTCATTGCAACAAGTTCGCAAACAGAATATACAATTTCAGCCGTCAAAATCCGGTGGACCCTACACTAAACAAGGCTTAC
GCAGCTCAGCTTCAGGCGATGTGTCCCAAGAAAGTGGACCCCAGGATAGCCATAAACATGGATCCAAACACCCCCCGAACTTTTGACAACGCGTATTACAAGAACCTTGTAGAGGGAAAA
GGCCTATTCACATCGGATCAAATCCTCTTCACCGACCCGAGATCCAAGTCCACCGTGATGGCATGGGCAGGAAACAAAGCGGCCTTTGAGAAAGCCTTTATTGCTGCCATGACTAAATTG
GGTCGGGTCGGAGTCAAGACCGGAACAAACGGAAATATTCGTCGTAATTGCGCTGCTTTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTTCAGTTGGGTGGTAGTGGTGTTGTCACTTTGTCTTTACGCTGCATCGGCTCAGGTGCTTAAACAGAACTTTTACGCTAATGTCTGTCCCAACGTTGAATCCATTGTAAGA
GGCGTCGTCCGACAGAAGTTCCAACAGACCTTCGTCACTGTCCCCGCCACTCTCCGGCTTTTCTTCCATGATTGCGTTGTTCAG
GGGTGCGATGCTTCGGTAATTGTTGCATCGACGGGA
AGCAACACGGCGGAGAAAGACCACCCGGATAATTTATCGTTGGCCGGAGATGGATTCGATACCGTGATTAAAGCCAAAGCTGCTGTAGATGCAATCCCTAGTTGCAGAAACAAGGTCTCT
TGTGCTGACATTCTCGCCATGGCCACCCGAGATGTCATTGCTTTG
GCTGGTGGACCGTCGTATGCGGTTGAGCTGGGAAGACTTGACGGGCTAAGCTCAACGGCTAAAAGTGTAAATGGG
AAATTGCCGCAGCCTAACTTCAATCTCAACCAGCTCAATTCTCTCTTTGCTGCTATTGGCCTTACCCAAACTGACATGATTGCCCTCTCCG
CCGCCCACACCCTTGGGTTCTCTCATTGC
AACAAGTTCGCAAACAGAATATACAATTTCAGCCGTCAAAATCCGGTGGACCCTACACTAAACAAGGCTTACGCAGCTCAGCTTCAGGCGATGTGTCCCAAGAAAGTGGACCCCAGGATA
GCCATAAACATGGATCCAAACACCCCCCGAACTTTTGACAACGCGTATTACAAGAACCTTGTAGAGGGAAAAGGCCTATTCACATCGGATCAAATCCTCTTCACCGACCCGAGATCCAAG
TCCACCGTGATGGCATGGGCAGGAAACAAAGCGGCCTTTGAGAAAGCCTTTATTGCTGCCATGACTAAATTGGGTCGGGTCGGAGTCAAGACCGGAACAAACGGAAATATTCGTCGTAAT
TGCGCTGCTTTTAATTGA

Retrieve as FASTA