Entry information : CpapPrx53 (CpPOD30 / evm.model.supercontig_7.30)
Entry ID 8778
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx53 (CpPOD30 / evm.model.supercontig_7.30)
Name (synonym) CpapPrx53 (CpPOD30 / evm.model.supercontig_7.30)
Class Class III peroxidase    [Orthogroup: Prx035]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx53
start..stop
S start..stop
CppPrx08 550 0 14..336 21..354
CsPrx13 550 0 9..336 17..355
CclPrx92 545 0 17..336 26..356
MePrx10 544 0 13..335 23..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 378032..378262 231 N° 2 378340..378540 201 N° 3 379832..380410 579  
join(378032..378262,378340..378540,379832..380410)


exon

Literature and cross-references CpapPrx53 (CpPOD30 / evm.model.supercontig_7.30)
DNA ref. Phytozome 11:   supercontig_7 (378032..380410)
Protein sequence: CpapPrx53 (CpPOD30 / evm.model.supercontig_7.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (314)
PWM (Da):   %s   36923.3 (34526.9)  
PI (pH):   %s   9.52 (9.52) Peptide Signal:   %s   cut: 23 range:23-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPSIPSLLTVTLLLSFSLSLSKPAGRRRRELIVDYYAKSCPQVEQLIASLTSQHFKEAPVSGPATIRLFFHDCFVDGCDGSILIAAKAGSKELTEKDAEDNKELRGEGFEIVRQAKAVLESKCPGVVSCSDILAIAARDFVHLAGGPYYQVKKGRWDGKISIASRVKSNLPQSNSTVDQLIKLFSSKGLTINDLVVLSGAHTIGFAHCKEFVNRLYDFRGTKQPDPAIDPRLLKELRMSCPRFGGSADVVAPFDVTTPFLFDHAYYANLGAKMGLLASDQALFLDPRTKPLVQELGKDKQKFFQAFGVAMEKMGSIGVKRGRRHGEKRRDCSLHV*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCCTTCCATTCCTTCTTTACTCACCGTTACTCTCTTGCTCTCATTCTCTCTCTCTCTCTCCAAACCCGCCGGCCGCCGCCGCCGTGAACTCATAGTCGATTACTATGCTAAGTCA
TGTCCTCAGGTGGAGCAGCTAATCGCTTCACTCACCTCCCAACACTTCAAGGAAGCTCCAGTTTCAGGCCCTGCCACAATTCGTCTCTTTTTCCATGACTGCTTCGTCGAT
GTACTAATT
CTACATCCTTCTAATCTCTCATTTCCCTGCATTAGGTTATATATGCCTTTAATTGGATGTGGTTGCAGGGTTGTGATGGCTCAATATTGATAGCAGCAAAGGCGGGAAGCAAGGAGTTGA
CAGAGAAAGATGCAGAGGATAACAAGGAATTGAGAGGGGAAGGGTTTGAGATTGTAAGACAGGCAAAGGCTGTGTTGGAGAGTAAGTGCCCTGGGGTTGTGTCTTGTTCAGATATTCTCG
CCATTGCAGCTAGAGATTTTGTCCATTTG
GTTAGTACTCTTTTTTTTTTTTTTTCTTAAATTAATTTTTTCAACTTTACTGATTTCCTAAACTATGATCTTCTACCCAGAAAATTGTGAT
TAAACTTGTCAGGGTTCTTCATTTCTTAAATCTATTTTTTTGTCTGTTGATTGTTTGTTTGTTTGTTTGTTTTATGTGCAAATTAATTAGTAAACATATATAGAACTAGTTAAGAAACTA
AGAGATCAGAGAATTGATTTGCTACAAAGAATCTTCCAAGGAGTTGGCTGATGCTAGTGCCAAATCTGATGTGTCATTTTGTTTTTGTTCTTTCTTCTTGTTTTTTTCCATTGTTATTCT
TCTTCTGGGCTTATATCCATTTATTATTTTGAAGAAGGCATTGTTCTGACAAGAAAATCCACTAAAAAATTTTTTTCTGTTAAGTTGTATGTTTATGTGGAAGTATATATATGTGCACTA
TACTATACATTGTCTTTTGAGTTATATGCTGCCGCTGAGTGTACAATTTCAAGACATGATTTAACATATTTGAATTCATACACAAAGTGGGATCCATCACTAACTGTTTGAAGATGGGAC
ATATGCACTGAAAGCACTATGTAATTTACTTATTTTTTTAAGAATTGTAATTTATTTATTACAGCAAGCACAAACATGTTTAACAAGATCCCAATGTAGGAAGTTGGGAGAAATGGTGTT
TACCCATTTCTGCAGATCATGATAGAAAAAATCAAGATGTACTTATATATGCCTGTTTTGTCTTTTATTCAAATTTTTGTCCTTAAGAACAAAAATCTTCTGTTAAACTTGTCATATTGC
TTTTGTTCTTGATTGTTGATTATTGAGCAAACAAAGATAAACTATCCTAGCCTCCAGTCAAGAACATGCCAACCAATATTTATTAGATTAATGGCAATAATTCATTACTATTACTATCCT
TGCACAAATCTCTATGCAAATATTATTCTGCATTAAATATAATCCTTTGGTAAAAGCATCTAGCTAAGAAAAGGAAATCTCAATGAAGTTCTTAGTTCTCCAGCTTCAGAAAGTATAGGG
ATTATCTATATATATATATATTTAATGATTTTGACAGCTAAATTAATTTAAATTTTGTAAATGAATCAATTTTTTGATTAAATTGTTAATATTTTCGCTTATTTTTATGAGAGTATGAAT
TTAAGTTGAAATGTGCGTTTTATGTACACTTATTAAAAAGTTACGGTATTGATTGTATTGTTATTAAATATCACTTAATTAAATTTTTATTGAAAAAACTGTAATTTTTTGAATTTGCAG

GCTGGAGGGCCTTATTATCAAGTCAAGAAAGGAAGATGGGATGGAAAGATATCAATAGCATCAAGGGTTAAATCCAACCTTCCACAATCAAATTCAACAGTTGATCAATTGATCAAGCTC
TTCAGTTCCAAAGGTTTAACCATCAATGATCTTGTCGTCCTCTCTGGTGCACATACAATTGGTTTTGCACACTGCAAAGAATTTGTTAACAGACTATATGATTTCCGAGGCACCAAGCAA
CCGGACCCTGCAATTGATCCAAGATTGCTAAAAGAACTAAGAATGTCATGCCCTCGTTTTGGAGGCAGTGCTGATGTTGTTGCACCATTTGATGTCACCACCCCATTCTTGTTTGACCAC
GCTTATTATGCAAACTTGGGTGCCAAAATGGGACTTTTGGCATCAGACCAAGCCTTGTTTTTGGACCCAAGAACCAAGCCTCTGGTTCAGGAGCTTGGGAAAGATAAGCAGAAGTTCTTT
CAAGCTTTTGGTGTTGCTATGGAGAAAATGGGTTCAATAGGAGTAAAGAGAGGAAGGAGACATGGAGAGAAGAGGAGGGATTGTAGTCTGCACGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCCTTCCATTCCTTCTTTACTCACCGTTACTCTCTTGCTCTCATTCTCTCTCTCTCTCTCCAAACCCGCCGGCCGCCGCCGCCGTGAACTCATAGTCGATTACTATGCTAAGTCA
TGTCCTCAGGTGGAGCAGCTAATCGCTTCACTCACCTCCCAACACTTCAAGGAAGCTCCAGTTTCAGGCCCTGCCACAATTCGTCTCTTTTTCCATGACTGCTTCGTCGAT
GGTTGTGAT
GGCTCAATATTGATAGCAGCAAAGGCGGGAAGCAAGGAGTTGACAGAGAAAGATGCAGAGGATAACAAGGAATTGAGAGGGGAAGGGTTTGAGATTGTAAGACAGGCAAAGGCTGTGTTG
GAGAGTAAGTGCCCTGGGGTTGTGTCTTGTTCAGATATTCTCGCCATTGCAGCTAGAGATTTTGTCCATTTG
GCTGGAGGGCCTTATTATCAAGTCAAGAAAGGAAGATGGGATGGAAAG
ATATCAATAGCATCAAGGGTTAAATCCAACCTTCCACAATCAAATTCAACAGTTGATCAATTGATCAAGCTCTTCAGTTCCAAAGGTTTAACCATCAATGATCTTGTCGTCCTCTCTGGT
GCACATACAATTGGTTTTGCACACTGCAAAGAATTTGTTAACAGACTATATGATTTCCGAGGCACCAAGCAACCGGACCCTGCAATTGATCCAAGATTGCTAAAAGAACTAAGAATGTCA
TGCCCTCGTTTTGGAGGCAGTGCTGATGTTGTTGCACCATTTGATGTCACCACCCCATTCTTGTTTGACCACGCTTATTATGCAAACTTGGGTGCCAAAATGGGACTTTTGGCATCAGAC
CAAGCCTTGTTTTTGGACCCAAGAACCAAGCCTCTGGTTCAGGAGCTTGGGAAAGATAAGCAGAAGTTCTTTCAAGCTTTTGGTGTTGCTATGGAGAAAATGGGTTCAATAGGAGTAAAG
AGAGGAAGGAGACATGGAGAGAAGAGGAGGGATTGTAGTCTGCACGTGTGA

Retrieve as FASTA