Entry information : CpapPrx55 (CpPOD31 / evm.model.supercontig_8.230)
Entry ID 8780
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-14 (Christophe Dunand)
Peroxidase information: CpapPrx55 (CpPOD31 / evm.model.supercontig_8.230)
Name (synonym) CpapPrx55 (CpPOD31 / evm.model.supercontig_8.230)
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx55
start..stop
S start..stop
CpapPrx56 492 4e-177 32..325 32..325
VvPrx30 484 3e-174 1..325 1..327
VvPrx31 475 1e-170 1..325 1..327
PtPrx29 462 1e-165 1..325 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1651516..1651734 219 N° 2 1650886..1651071 186 N° 3 1650162..1650734 573  
complement(join(1650162..1650734,1650886..1651071,1651516..1651734))


exon

Literature and cross-references CpapPrx55 (CpPOD31 / evm.model.supercontig_8.230)
DNA ref. Phytozome 11:   supercontig_8 (1651734..1650162)
Protein sequence: CpapPrx55 (CpPOD31 / evm.model.supercontig_8.230)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (300)
PWM (Da):   %s   35653.72 (32880.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.68 (9.58) Peptide Signal:   %s   cut: 26 range:26-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIKNLVSAFIFLLVLVLPAHLANAHYLHRDFYREKCPQAEHIVYYITYKFISKNPSLAAALLRMHFHDCFVRGCDGSVLLTSSKKNAERDAIPNLSLRGFEVIDTVKSALEKACPRVVSCADILALVARDAVTIINGPHWEVPTGRRDGKVSIKSEALTNLPPPFANITVLKQMFAVKGLNVKDLAVLSGGHTIGISHCGSFSNRLYNFTGKGDTDPTLDPNYVVQLKKKCKPGDQNTLVEMDPGSVKTFDVNYYKVVAQRRGLFQSDAALLNDVATQAYVRLQALTRGLTFAGDFAVSMEKMGKIGVLTGKAGEIRKKCGFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATCAAAAACCTTGTTTCTGCCTTCATCTTTCTTCTGGTTTTGGTTTTGCCCGCACACCTCGCAAATGCCCATTACTTGCATCGAGATTTCTACCGTGAGAAATGTCCTCAAGCT
GAGCACATTGTTTACTACATTACTTATAAATTCATCTCCAAAAACCCTTCTCTTGCAGCTGCTTTGCTCAGGATGCATTTTCATGATTGTTTTGTTCGT
GTAAGTTCACGATTTTCTTTC
TTCGTTTTAAAGAGCATTATACTCATTGTAAGCGTAATGTTTTTTTTTATTGTCCCAATTCAAATATGTAATTAGAAATGCATATTAATTATGAAAATAATAATTATTTATCTTAGTAAA
TAATTTAAAAAAATATATATTTTACTGAGGAATTAAGATTATAAATATGTGCATTTTAAATTTTTATGAAGGATTCATATCTTAAATTTAATTATAATCATAAATGAAACTTAATTATGA
TACAAATATTATAGTGTCTATATATACTCATATATTCATAAATTATTATCATAAAAAATTAATTTTTTCTATTAGTTTCTGATTCTTTTTTCTCCTACTTTTAATAAATTATTACCTACA
GTTAGATTATCTCTTAACATTTTGTAAGATTAATTACTGATATAGGTTGGGGAATATTTGCAGGGATGTGACGGGTCTGTACTTCTAACTTCTTCAAAAAAGAATGCAGAAAGAGATGCG
ATTCCGAACCTCAGTTTGCGGGGATTCGAAGTAATTGATACTGTAAAATCTGCATTAGAAAAGGCTTGTCCAAGAGTTGTTTCTTGTGCTGATATTCTTGCTTTAGTTGCTAGAGATGCT
GTTACCATA
GTAAGTATATACTCTATACTTATGAACAATATACATATATATATATATATAATAGCATTATTACAAATATTTCATAACAGTTTCTATAAGAAATATATTATATATATATAT
ATATGTATGTATAAAATAAGAACGTTCATGCGAATCTCAGATCAATGGCCCGCACTGGGAAGTCCCAACCGGACGACGAGACGGTAAAGTGTCAATTAAATCGGAGGCGCTAACAAACTT
GCCGCCACCTTTCGCCAACATAACAGTGCTCAAGCAAATGTTTGCCGTCAAGGGTTTGAACGTCAAAGACCTGGCTGTCTTGTCCGGAGGCCACACCATCGGAATCTCTCACTGCGGAAG
CTTCAGCAACCGCCTCTATAACTTCACCGGCAAAGGCGATACCGACCCAACTCTGGATCCAAACTACGTCGTTCAGTTGAAGAAAAAGTGTAAGCCTGGAGACCAAAATACCCTTGTGGA
GATGGACCCTGGTAGTGTCAAAACCTTCGACGTCAACTACTATAAAGTCGTGGCTCAGAGACGAGGATTGTTTCAGTCTGATGCAGCACTTTTAAACGATGTTGCGACCCAAGCTTACGT
TAGGCTCCAGGCGCTTACTCGTGGACTCACTTTCGCCGGAGACTTTGCTGTGTCTATGGAGAAAATGGGAAAGATTGGAGTGTTGACTGGTAAGGCTGGTGAAATCAGGAAGAAATGTGG
TTTTGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATCAAAAACCTTGTTTCTGCCTTCATCTTTCTTCTGGTTTTGGTTTTGCCCGCACACCTCGCAAATGCCCATTACTTGCATCGAGATTTCTACCGTGAGAAATGTCCTCAAGCT
GAGCACATTGTTTACTACATTACTTATAAATTCATCTCCAAAAACCCTTCTCTTGCAGCTGCTTTGCTCAGGATGCATTTTCATGATTGTTTTGTTCGT
GGATGTGACGGGTCTGTACTT
CTAACTTCTTCAAAAAAGAATGCAGAAAGAGATGCGATTCCGAACCTCAGTTTGCGGGGATTCGAAGTAATTGATACTGTAAAATCTGCATTAGAAAAGGCTTGTCCAAGAGTTGTTTCT
TGTGCTGATATTCTTGCTTTAGTTGCTAGAGATGCTGTTACCATA
ATCAATGGCCCGCACTGGGAAGTCCCAACCGGACGACGAGACGGTAAAGTGTCAATTAAATCGGAGGCGCTAACA
AACTTGCCGCCACCTTTCGCCAACATAACAGTGCTCAAGCAAATGTTTGCCGTCAAGGGTTTGAACGTCAAAGACCTGGCTGTCTTGTCCGGAGGCCACACCATCGGAATCTCTCACTGC
GGAAGCTTCAGCAACCGCCTCTATAACTTCACCGGCAAAGGCGATACCGACCCAACTCTGGATCCAAACTACGTCGTTCAGTTGAAGAAAAAGTGTAAGCCTGGAGACCAAAATACCCTT
GTGGAGATGGACCCTGGTAGTGTCAAAACCTTCGACGTCAACTACTATAAAGTCGTGGCTCAGAGACGAGGATTGTTTCAGTCTGATGCAGCACTTTTAAACGATGTTGCGACCCAAGCT
TACGTTAGGCTCCAGGCGCTTACTCGTGGACTCACTTTCGCCGGAGACTTTGCTGTGTCTATGGAGAAAATGGGAAAGATTGGAGTGTTGACTGGTAAGGCTGGTGAAATCAGGAAGAAA
TGTGGTTTTGTGAATTGA

Retrieve as FASTA