Entry information : CpapPrx56 (evm.model.supercontig_8.231)
Entry ID 8781
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapPrx56 (evm.model.supercontig_8.231)
Name (synonym) CpapPrx56 (evm.model.supercontig_8.231)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx56
start..stop
S start..stop
CpapPrx55 513 0 1..325 1..325
VvPrx30 474 6e-170 1..325 1..327
CclPrx104 472 3e-169 1..325 1..328
VvPrx31 469 3e-168 1..325 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1652849..1653067 219 N° 2 1653174..1653359 186 N° 3 1653449..1654021 573  
join(1652849..1653067,1653174..1653359,1653449..1654021)


exon

Literature and cross-references CpapPrx56 (evm.model.supercontig_8.231)
DNA ref. Phytozome 11:   supercontig_8 (1652849..1654021)
Protein sequence: CpapPrx56 (evm.model.supercontig_8.231)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (300)
PWM (Da):   %s   35706.67 (32803.9) Transmb domain:   %s   i7-25o
PI (pH):   %s   10.09 (9.81) Peptide Signal:   %s   cut: 26 range:26-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATRKRLSLLLLQLLLVLALHLAHAHRLKLRFYKNTCPNAEAIVRNTTYKFISKAPTLAAALLRMHFHDCFVRGCDGSVLLTSSKENAERDASPNRSLRGFQVIDAVKSALEEACPCTVSCADIIALVARDAVSLIGGPFWDLPTGRRDGRVSLKSEVRPNVPSPSSNVTVLKQMFSVKGLSVKDLVVLSGSHTIGISHCRSFGNRLYNFTGKGEADPSMDPNYVVWLKKKCKPGDRTTLVEMDPGSFRTFDVNYYKVVTQRRGLFQSDAALLNDVQTQAYVKLQAENDGVSFAGDFAISMVKMGKIGVLTGKASEIRKKCAFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCCGAAAGCGTCTTTCGCTCCTCTTACTTCAACTCCTTCTTGTTCTAGCCCTGCACCTCGCACATGCGCACCGCCTGAAACTTCGATTCTACAAGAACACCTGCCCTAACGCC
GAGGCTATCGTTCGTAATACCACTTATAAATTCATTTCCAAGGCCCCAACTCTTGCAGCTGCCCTCCTAAGGATGCATTTTCATGACTGCTTCGTTCGA
GTATGCTCTTACAACAATATT
ATGTGTATATATATATATATATATATATATACGTATATCATTTAAAGTTATTGCTACTATCTAATGAGATGGGTTCAATTTGCAGGGATGTGATGGGTCTGTTCTTTTAACTTCTTCAAA
AGAGAATGCGGAGAGAGATGCCAGTCCAAACCGCAGCTTAAGAGGGTTTCAAGTTATTGATGCTGTAAAATCTGCACTAGAAGAGGCCTGTCCTTGCACGGTTTCTTGCGCTGATATTAT
TGCTTTAGTTGCCAGAGACGCAGTTTCTCTG
GTACATATATATACATAGTCTATATTTTCGACACACGTAAACTAATGCATTCATCTTCTACAATTTTATAATTAATGTGTCTGTCTCAG

ATTGGTGGACCATTTTGGGACCTTCCAACCGGCAGAAGAGATGGAAGAGTATCACTTAAATCAGAGGTGAGACCCAACGTGCCGTCTCCCTCTTCTAACGTAACAGTGCTCAAACAAATG
TTCAGCGTCAAGGGTCTGAGCGTCAAAGACCTGGTCGTCTTGTCCGGAAGCCACACCATCGGAATCTCTCACTGCAGAAGCTTCGGCAACCGTCTCTACAACTTCACCGGAAAAGGCGAG
GCCGACCCATCTATGGATCCAAACTACGTCGTTTGGTTGAAGAAGAAGTGCAAACCAGGGGACCGTACTACCCTTGTGGAGATGGACCCTGGTAGCTTCAGAACCTTCGACGTCAACTAC
TACAAAGTCGTGACTCAGAGGCGAGGATTGTTTCAGTCTGATGCAGCACTTCTAAACGATGTTCAGACCCAAGCCTATGTTAAGCTCCAGGCGGAGAATGATGGAGTCAGCTTTGCGGGA
GACTTTGCAATATCAATGGTGAAGATGGGGAAAATTGGAGTGTTGACTGGTAAAGCTAGTGAAATCAGGAAGAAGTGCGCTTTCGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCCGAAAGCGTCTTTCGCTCCTCTTACTTCAACTCCTTCTTGTTCTAGCCCTGCACCTCGCACATGCGCACCGCCTGAAACTTCGATTCTACAAGAACACCTGCCCTAACGCC
GAGGCTATCGTTCGTAATACCACTTATAAATTCATTTCCAAGGCCCCAACTCTTGCAGCTGCCCTCCTAAGGATGCATTTTCATGACTGCTTCGTTCGA
GGATGTGATGGGTCTGTTCTT
TTAACTTCTTCAAAAGAGAATGCGGAGAGAGATGCCAGTCCAAACCGCAGCTTAAGAGGGTTTCAAGTTATTGATGCTGTAAAATCTGCACTAGAAGAGGCCTGTCCTTGCACGGTTTCT
TGCGCTGATATTATTGCTTTAGTTGCCAGAGACGCAGTTTCTCTG
ATTGGTGGACCATTTTGGGACCTTCCAACCGGCAGAAGAGATGGAAGAGTATCACTTAAATCAGAGGTGAGACCC
AACGTGCCGTCTCCCTCTTCTAACGTAACAGTGCTCAAACAAATGTTCAGCGTCAAGGGTCTGAGCGTCAAAGACCTGGTCGTCTTGTCCGGAAGCCACACCATCGGAATCTCTCACTGC
AGAAGCTTCGGCAACCGTCTCTACAACTTCACCGGAAAAGGCGAGGCCGACCCATCTATGGATCCAAACTACGTCGTTTGGTTGAAGAAGAAGTGCAAACCAGGGGACCGTACTACCCTT
GTGGAGATGGACCCTGGTAGCTTCAGAACCTTCGACGTCAACTACTACAAAGTCGTGACTCAGAGGCGAGGATTGTTTCAGTCTGATGCAGCACTTCTAAACGATGTTCAGACCCAAGCC
TATGTTAAGCTCCAGGCGGAGAATGATGGAGTCAGCTTTGCGGGAGACTTTGCAATATCAATGGTGAAGATGGGGAAAATTGGAGTGTTGACTGGTAAAGCTAGTGAAATCAGGAAGAAG
TGCGCTTTCGTGAATTGA

Retrieve as FASTA