Entry information : CpapPrx57 (evm.model.supercontig_8.232)
Entry ID 8782
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapPrx57 (evm.model.supercontig_8.232)
Name (synonym) CpapPrx57 (evm.model.supercontig_8.232)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx57
start..stop
S start..stop
ThasPrx07 521 0 1..324 1..322
BstrPrx53 521 0 11..324 11..322
BrPrx03-1Aa_other 521 0 11..324 13..324
CagraPrx16 520 0 7..324 11..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1656069..1656275 207 N° 2 1656363..1656551 189 N° 3 1656626..1656788 163 N° 4 1656947..1657368 422
join(1656069..1656275,1656363..1656551,1656626..1656788,1656947..1657368)


exon

Literature and cross-references CpapPrx57 (evm.model.supercontig_8.232)
DNA ref. Phytozome 11:   supercontig_8 (1656069..1657368)
Protein sequence: CpapPrx57 (evm.model.supercontig_8.232)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35404.93 (32998.7)  
PI (pH):   %s   8.39 (8.57) Peptide Signal:   %s   cut: 23 range:23-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMNWSGLLVFLVFLGVIASGEAQLQMNYYARTCPKAEKIVQDFINKHIHNAPSLAAPLIRMHFHDCFVRGCDGSVLINSTSGNAEKDATPNLTLRGFNFIESIKSLLEAECPGVVSCADIIALAARDSVVLTGGPSWRVPTGRRDGLISNSSEALNDIPSPFSNFTTLQRLFANQGLDLKDLVLLSGAHTIGVSHCSSFNNRLFNFTGRGDQDPALDSEYAANLKAFKCRSLSLSDNNTLVEMDPGSRKTFDLGYYKQVIKRRGLFQSDSALTTSSTTLSYINQLLKGSLQDFFTEFAKSMEKMGGVNVKTGSAGVIRKKCSVAAA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAATTGGTCAGGCTTATTAGTCTTCTTGGTTTTCTTAGGAGTAATAGCATCGGGTGAAGCACAGTTGCAGATGAACTACTATGCTAGGACTTGCCCAAAAGCTGAGAAGATTGTC
CAGGATTTCATCAACAAGCACATTCATAATGCTCCATCATTGGCTGCACCGCTCATCAGAATGCATTTCCATGATTGTTTTGTCAGA
GTAAGTAATTAACTTTGTCTTTGAAGTGCTCAA
AACTCATGATCTGTGCTGAAACTCTTCTTGTGTTTTTGTTATGTGGGTGGCAAGGGGTGTGATGGATCTGTGCTTATAAACTCAACTTCAGGCAACGCAGAGAAGGATGCTACACCAAAT
TTGACACTTAGAGGGTTCAATTTCATTGAGAGTATAAAGAGTTTGCTGGAAGCTGAATGTCCTGGGGTTGTCTCCTGCGCAGATATAATTGCTTTGGCCGCAAGAGATTCCGTTGTACTC
ACT
GTAAGTAATTTCTTTGCAGAACAAATTTCATTTCTTTGAATTCTTTGTTGGGTTCCTAATTTGATTTTCAAAAGGGAGGACCGTCTTGGAGAGTTCCAACGGGAAGACGAGATGGGT
TGATCTCAAATTCCTCAGAAGCTTTAAATGATATCCCATCTCCATTCAGCAACTTCACCACCCTGCAAAGACTCTTCGCCAATCAAGGACTTGACCTCAAAGACTTGGTTTTACTTTCCG
GTAAAAACCCACGAAAGAGTTACAGTTGTTTCCCAAAAATTTATATATTTTATTAATTAAGCAATATATACACATTAATCATGACAAATTTTAAAACACAAGAGTCAAAAAATAATTGGT
ACGGAAGAAAATTTATTAGTATGTTGGTGTATTTTTAGGTGCTCATACAATTGGAGTTTCTCATTGCTCATCGTTCAACAACCGGCTATTTAACTTCACCGGAAGAGGCGATCAAGACCC
TGCTCTTGACAGCGAATATGCAGCCAATCTAAAGGCCTTTAAGTGCAGAAGTTTGAGCCTTAGTGACAACAACACACTAGTGGAAATGGACCCAGGAAGTCGGAAAACATTCGATCTCGG
ATATTACAAACAGGTGATCAAGAGAAGAGGTCTATTCCAATCTGATTCTGCTCTCACAACATCCTCCACAACCCTCTCTTACATTAACCAGCTGCTCAAGGGATCTCTTCAAGACTTCTT
TACAGAGTTTGCCAAGTCCATGGAGAAAATGGGAGGAGTCAATGTCAAGACCGGATCCGCCGGTGTCATAAGGAAAAAATGTTCAGTGGCCGCTGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAATTGGTCAGGCTTATTAGTCTTCTTGGTTTTCTTAGGAGTAATAGCATCGGGTGAAGCACAGTTGCAGATGAACTACTATGCTAGGACTTGCCCAAAAGCTGAGAAGATTGTC
CAGGATTTCATCAACAAGCACATTCATAATGCTCCATCATTGGCTGCACCGCTCATCAGAATGCATTTCCATGATTGTTTTGTCAGA
GGGTGTGATGGATCTGTGCTTATAAACTCAACT
TCAGGCAACGCAGAGAAGGATGCTACACCAAATTTGACACTTAGAGGGTTCAATTTCATTGAGAGTATAAAGAGTTTGCTGGAAGCTGAATGTCCTGGGGTTGTCTCCTGCGCAGATATA
ATTGCTTTGGCCGCAAGAGATTCCGTTGTACTCACT
GGAGGACCGTCTTGGAGAGTTCCAACGGGAAGACGAGATGGGTTGATCTCAAATTCCTCAGAAGCTTTAAATGATATCCCATCT
CCATTCAGCAACTTCACCACCCTGCAAAGACTCTTCGCCAATCAAGGACTTGACCTCAAAGACTTGGTTTTACTTTCCG
GTGCTCATACAATTGGAGTTTCTCATTGCTCATCGTTCAAC
AACCGGCTATTTAACTTCACCGGAAGAGGCGATCAAGACCCTGCTCTTGACAGCGAATATGCAGCCAATCTAAAGGCCTTTAAGTGCAGAAGTTTGAGCCTTAGTGACAACAACACACTA
GTGGAAATGGACCCAGGAAGTCGGAAAACATTCGATCTCGGATATTACAAACAGGTGATCAAGAGAAGAGGTCTATTCCAATCTGATTCTGCTCTCACAACATCCTCCACAACCCTCTCT
TACATTAACCAGCTGCTCAAGGGATCTCTTCAAGACTTCTTTACAGAGTTTGCCAAGTCCATGGAGAAAATGGGAGGAGTCAATGTCAAGACCGGATCCGCCGGTGTCATAAGGAAAAAA
TGTTCAGTGGCCGCTGCCTAA

Retrieve as FASTA