Entry information : CpapPrx59 (evm.model.supercontig_845.4)
Entry ID 8784
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-01 (Qiang Li)
Peroxidase information: CpapPrx59 (evm.model.supercontig_845.4)
Name (synonym) CpapPrx59 (evm.model.supercontig_845.4)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx59
start..stop
S start..stop
CclPrx116 495 2e-178 1..322 1..322
GhPrx05 493 1e-177 3..322 4..323
VvPrx12 476 9e-171 1..322 9..328
GmPrx03 469 3e-168 3..322 4..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18928..19125 198 N° 2 18644..18826 183 N° 3 18307..18469 163 N° 4 17206..17632 427
complement(join(17206..17632,18307..18469,18644..18826,18928..19125))


exon

Literature and cross-references CpapPrx59 (evm.model.supercontig_845.4)
DNA ref. Phytozome 12:   supercontig_845 (19125..17206)
Protein sequence: CpapPrx59 (evm.model.supercontig_845.4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (304)
PWM (Da):   %s   34590.46 (32439.3)  
PI (pH):   %s   4.8 (4.89) Peptide Signal:   %s   cut: 20 range:20-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMVLSFLLIILFVQICESQVQIGFYSQTCPDAESIITRVVSDAAVSNPNMPAVLLRLHFHDCFVQGCDGSILIENGTNAERHAFGHQGVGGFEVIERAKAELEAVCPGVVSCADIVALAARDAVALAQGPEYQVPTGRRDGRVSSVSLADDMPDVGDSIQQLKAKFLRKGLSDKDLVLLSAAHTIGTTACFFMTNRLxNFALSSTGSDPQINPSFLPELKATCPRDGNVNVRLPIDRGSERTFDKQILQNIRDGFAVLESDARLYDDVSTRSVIDSYFGPLSPFLGPSFEADFVESIIKMGVIDIKTGSAGGIRRTCASFNT

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Exon 4 is missing which has been completed). complement(join(17206..17632,18307..18469,18644..18826,18928..19125))
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTATGGTTTTGAGCTTCTTGTTGATTATCCTGTTTGTGCAGATATGTGAGAGCCAAGTTCAAATCGGATTTTATTCCCAGACTTGCCCTGACGCTGAGTCAATAATCACCAGAGTTG
TTTCAGATGCTGCGGTCTCTAACCCTAACATGCCTGCCGTCTTGCTCAGGCTCCATTTCCATGACTGCTTTGTCCAGG
TCTCCTCCCTCTTCACACATATATATGTGTATGTATGTTTCA
TTTTGGTGTAAAATTATTGTTGAATTGATTATACACATACACATACATATATTAATAGGGATGTGATGGGTCGATTCTGATTGAGAATGGAACAAATGCGGAGAGACATGCCTTTGGCCA
CCAAGGAGTTGGAGGGTTTGAAGTGATAGAGAGAGCCAAAGCTGAGTTAGAAGCTGTATGTCCAGGAGTTGTTTCTTGTGCAGACATAGTAGCCTTGGCTGCTCGAGATGCCGTAGCTTT
GG
TATACATCTTTTATATATATAATAATACATATTTGTAGGAAATTTGGTAAAATGTCTTTTGCTTCACAATGTATGTTAATTATGTTTATAATTATAATATTAATGACATACCTCTCTT
GCATGTACCTTAAATTAACCTGTGTGATCACCAGCTGACATATACGTACGTGCAGGCGCAAGGACCTGAATATCAGGTTCCGACAGGGAGGAGAGATGGAAGAGTATCGAGTGTATCACT
GGCAGACGATATGCCGGATGTGGGTGACTCAATACAGCAATTGAAAGCCAAGTTTCTGCGCAAAGGCCTTTCAGACAAAGACCTGGTTCTTCTCTCTGG
TAACATACACAATAACTCTCT
CTCTCTCTCTCTCTCTCATGCATTTGTAGTGATGTCAAGGCCGGTACAAACCCCATCTCATATGAATCTTTAACGCGTACATATGTGCACATATACATATATCCTTCTCTCAATTCATTA
ATTAACTCTAAATTCCAAATTATCAATATGTATTAATTAAAAAATTTAATTGCGTGTTTTAGAAAAAGGACATGATATTTATATGATTATTTATCATAAAATTCAACAACAAAACAAAAG
AACCATATGATTTATTAAATAATAAAACACATTGGTTAGGGGGGGTTGGATCAAGTGGAGTAAAGAAACCGTGTCCTACTTCTTCAAAACAAAAAGAGGAAACCATGTGCTGTTTTTTCA
GTTTCTTTATTTATTTTATTGAAAATGACTTGCGGAATGGCCTCTCCCGTATACACCACCAAAACTATATAATTTCCATGGAAATTAAATTATATTTATTATGAACTAATTAATTTTATG
ACCAAATGCCCTCACCATTATCAGTGGCAGGTGGCACAGTTTTAGTCACACCCATTTATGAGACGTACATAAAATAAATAAAATATTAATCTGATTTATTCGATGCAATCATAATATAAT
TTATTTACGTTTTAAATTAAATTAAAATTAATTGTTCTTCCGATTGCATCAGCTGCGCATACCATTGGAACCACAGCATGCTTTTTCATGACCAACCGGCTTACNAATTTCGCTCTGAGT
TCCACTGGATCTGATCCACAAATCAACCCCAGTTTCTTACCAGAGTTAAAGGCCACGTGTCCTCGAGACGGCAACGTTAACGTCCGGCTACCCATCGATCGCGGCAGCGAACGGACGTTT
GATAAACAGATTCTACAGAACATCAGGGATGGATTTGCGGTTCTTGAATCTGACGCTAGATTATACGACGACGTTTCAACGAGAAGTGTTATCGACTCTTACTTTGGGCCTCTAAGCCCA
TTTCTAGGCCCATCGTTTGAGGCCGATTTTGTTGAATCGATCATAAAGATGGGTGTCATCGATATTAAAACTGGATCGGCTGGAGGGATCAGACGTACCTGTGCATCCTTCAATACTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTATGGTTTTGAGCTTCTTGTTGATTATCCTGTTTGTGCAGATATGTGAGAGCCAAGTTCAAATCGGATTTTATTCCCAGACTTGCCCTGACGCTGAGTCAATAATCACCAGAGTTG
TTTCAGATGCTGCGGTCTCTAACCCTAACATGCCTGCCGTCTTGCTCAGGCTCCATTTCCATGACTGCTTTGTCCAGG
GATGTGATGGGTCGATTCTGATTGAGAATGGAACAAATGCGG
AGAGACATGCCTTTGGCCACCAAGGAGTTGGAGGGTTTGAAGTGATAGAGAGAGCCAAAGCTGAGTTAGAAGCTGTATGTCCAGGAGTTGTTTCTTGTGCAGACATAGTAGCCTTGGCTG
CTCGAGATGCCGTAGCTTTGG
CGCAAGGACCTGAATATCAGGTTCCGACAGGGAGGAGAGATGGAAGAGTATCGAGTGTATCACTGGCAGACGATATGCCGGATGTGGGTGACTCAATAC
AGCAATTGAAAGCCAAGTTTCTGCGCAAAGGCCTTTCAGACAAAGACCTGGTTCTTCTCTCTGG
TGCGCATACCATTGGAACCACAGCATGCTTTTTCATGACCAACCGGCTTACNAATT
TCGCTCTGAGTTCCACTGGATCTGATCCACAAATCAACCCCAGTTTCTTACCAGAGTTAAAGGCCACGTGTCCTCGAGACGGCAACGTTAACGTCCGGCTACCCATCGATCGCGGCAGCG
AACGGACGTTTGATAAACAGATTCTACAGAACATCAGGGATGGATTTGCGGTTCTTGAATCTGACGCTAGATTATACGACGACGTTTCAACGAGAAGTGTTATCGACTCTTACTTTGGGC
CTCTAAGCCCATTTCTAGGCCCATCGTTTGAGGCCGATTTTGTTGAATCGATCATAAAGATGGGTGTCATCGATATTAAAACTGGATCGGCTGGAGGGATCAGACGTACCTGTGCATCCT
TCAATACTTAA

Retrieve as FASTA