Entry information : CpapPrx62 (evm.model.supercontig_95.38)
Entry ID 8787
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapPrx62 (evm.model.supercontig_95.38)
Name (synonym) CpapPrx62 (evm.model.supercontig_95.38)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx62
start..stop
S start..stop
EgrPrx68 531 0 6..331 1..325
EglPrx68 531 0 6..331 1..325
EgrPrx67 528 0 6..331 1..325
EguPrx68 528 0 6..331 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 613588..613812 225 N° 2 613908..614105 198 N° 3 614250..614415 166 N° 4 615196..615602 407
join(613588..613812,613908..614105,614250..614415,615196..615602)


exon

Literature and cross-references CpapPrx62 (evm.model.supercontig_95.38)
DNA ref. Phytozome 12:   supercontig_95 (613588..615602)
Protein sequence: CpapPrx62 (evm.model.supercontig_95.38)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (304)
PWM (Da):   %s   36719.86 (33628.2) Transmb domain:   %s   i12-30o
PI (pH):   %s   10.03 (9.94) Peptide Signal:   %s   cut: 28 range:28-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEIKSIKSQTFIAFSFIILFFVASASAQALRQNFYQNVCPNVESLVRSAVQKKFQQTFVTAPATLRLFFHDCFVRGCDASVLIASGNNQAEKDHPDDISLAGDGFDTVIKAKAAVDSDPKCRNKVSCADILALATRDVVALAGGPSYKVELGRRDGRISTIASVQHNLPRPDFSLDQLNNMFARHGLTQPDMIALSGAHTIGFSHCSKFSKRIYNFNPKSRIDPTLNRNYVFQLRQMCPLRVDSRIAINMDPTTPQTFDNAYYKNLQQGRGLFVSDQVLFSDQRSRGTVNLFASNNTAFIKAFVIAITKLGRVGVKTGRQGEIRIDCTRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAAATCGATCAAATCTCAAACCTTTATTGCTTTCTCATTCATAATTCTCTTCTTCGTAGCTTCTGCTTCTGCTCAAGCCCTCAGACAGAACTTCTACCAAAACGTATGCCCC
AACGTGGAGTCACTCGTCCGCTCCGCCGTCCAAAAGAAGTTCCAGCAAACCTTTGTCACCGCCCCTGCAACTCTCCGCCTCTTCTTCCATGATTGCTTTGTCCGG
GTAATTATTATCCAC
AAACATACAATTTTTGCAAATATTAATTTGTACGTAAACTATGATAGCATGTTTTTTATGATTTCTCCGTTTTATTATAGGGATGTGATGCGTCAGTATTGATAGCATCAGGTAATAATC
AGGCCGAGAAAGATCACCCGGATGATATATCACTTGCGGGAGACGGATTTGACACGGTCATCAAGGCCAAGGCTGCGGTTGATAGTGATCCAAAGTGCAGAAACAAAGTTTCTTGTGCTG
ATATTTTAGCTTTAGCTACCAGAGATGTTGTTGCATTG
GTACACTAGTATTAGTATTGTCATTTACACGAGACATAAATGTAGTGTGTGTGTGTGTGTGTGTGTATATATGTATGTATGT
ATGTATGTATTTTACATATACATTATTACATATAAATATATGTGGAATTATAAATATTGCAGGCAGGAGGACCATCTTATAAAGTTGAATTGGGGAGACGAGATGGAAGGATATCTACCA
TAGCCAGTGTTCAACACAACCTTCCTCGACCTGACTTCAGCTTAGACCAACTAAATAACATGTTTGCTCGTCACGGTCTCACCCAACCCGACATGATTGCCTTATCAG
GTATTATATATA
TATATATATTTTGAAGTCATATATGCGCATTGTTATCATATGTTCTAAACTATGCACGTATATGTATATATATGTATATATGCTTATGTTTGTGATTGAGCTGCCAAATTATAAATGTTA
GTGGTCTAAGGCTAATATATAGTTCATTTCAAAGAAAAATAAAAATTATAAATTTTACTAGAAAATTATAAAAGTTCATTTCAAATAAAATTCTATACAAACTTTGGAATGATGATTTTA
GATAAATTTTTTTAACATTTTTTAATTAAATTAAATATATATTCTTAATATTGTACAAGTTCATATTCTAAATATAACCTAATTATAATTTGTGATATGATGTTGATGGTAAATGAAATT
AACTTGAGAAATTGTAAGATTTTCACTTCAAGGCAAATTTACTAGTAGAAAAGATTTCAATACTTGATTTGAATTTAGATGATGTTCCATCATTCTTGGTCACATCAAACAAAACGACGG
ATCCCCCTATTCAACCAGGGGTGAAGTCCGGTTGTGAGATCAAGTTTTTATGAAATGGATAGTAGAAATCTCTATATTAGAAACTAAAATTAAATACTCTAAATTTAAGTTTAAAAATAT
AAATTATTTTTTAAATTTAGATTCATTTAAACCTATCAGTGATGAAGTTCTTCAACATAAATTGTTGGTTCGATAGAAAAAATAACTTGACTCAATTACAAAAAAACTCAGTTTTTATTA
CCTTTCAAGTTAAATTGACACTACTTATGTATTTTTTTTTTTGAATAGGTGCACACACAATTGGATTCTCTCATTGTAGCAAATTCTCAAAGAGAATTTACAACTTCAATCCTAAAAGTC
GAATTGATCCAACATTAAATCGTAATTATGTCTTTCAACTCAGACAGATGTGCCCCTTAAGAGTTGACTCGAGAATTGCTATCAATATGGATCCAACCACACCTCAAACATTTGATAATG
CTTATTACAAGAACCTTCAGCAAGGAAGAGGACTCTTTGTGTCTGATCAAGTATTATTTTCTGACCAAAGATCCAGAGGCACTGTTAATCTCTTTGCATCAAACAATACAGCCTTCATAA
AAGCTTTTGTCATAGCAATAACGAAGCTTGGTCGTGTTGGAGTTAAGACGGGAAGACAAGGTGAAATCAGAATAGATTGTACACGTCCAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAAATCGATCAAATCTCAAACCTTTATTGCTTTCTCATTCATAATTCTCTTCTTCGTAGCTTCTGCTTCTGCTCAAGCCCTCAGACAGAACTTCTACCAAAACGTATGCCCC
AACGTGGAGTCACTCGTCCGCTCCGCCGTCCAAAAGAAGTTCCAGCAAACCTTTGTCACCGCCCCTGCAACTCTCCGCCTCTTCTTCCATGATTGCTTTGTCCGG
GGATGTGATGCGTCA
GTATTGATAGCATCAGGTAATAATCAGGCCGAGAAAGATCACCCGGATGATATATCACTTGCGGGAGACGGATTTGACACGGTCATCAAGGCCAAGGCTGCGGTTGATAGTGATCCAAAG
TGCAGAAACAAAGTTTCTTGTGCTGATATTTTAGCTTTAGCTACCAGAGATGTTGTTGCATTG
GCAGGAGGACCATCTTATAAAGTTGAATTGGGGAGACGAGATGGAAGGATATCTACC
ATAGCCAGTGTTCAACACAACCTTCCTCGACCTGACTTCAGCTTAGACCAACTAAATAACATGTTTGCTCGTCACGGTCTCACCCAACCCGACATGATTGCCTTATCAG
GTGCACACACA
ATTGGATTCTCTCATTGTAGCAAATTCTCAAAGAGAATTTACAACTTCAATCCTAAAAGTCGAATTGATCCAACATTAAATCGTAATTATGTCTTTCAACTCAGACAGATGTGCCCCTTA
AGAGTTGACTCGAGAATTGCTATCAATATGGATCCAACCACACCTCAAACATTTGATAATGCTTATTACAAGAACCTTCAGCAAGGAAGAGGACTCTTTGTGTCTGATCAAGTATTATTT
TCTGACCAAAGATCCAGAGGCACTGTTAATCTCTTTGCATCAAACAATACAGCCTTCATAAAAGCTTTTGTCATAGCAATAACGAAGCTTGGTCGTGTTGGAGTTAAGACGGGAAGACAA
GGTGAAATCAGAATAGATTGTACACGTCCAAACTAG

Retrieve as FASTA