Entry information : CpapPrx66 (evm.TU.contig_36992.1)
Entry ID 8790
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapPrx66 (evm.TU.contig_36992.1)
Name (synonym) CpapPrx66 (evm.TU.contig_36992.1)
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx66
start..stop
S start..stop
CsPrx37 424 1e-150 12..319 9..315
CclPrx52 422 4e-150 12..319 9..315
PtPrx112 419 2e-148 8..319 9..321
StPrx32 410 3e-145 3..319 2..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1932..2144 213 N° 2 1481..1676 196 N° 3 188..731 544  
complement(join(188..731,1481..1676,1932..2144))


exon

Literature and cross-references CpapPrx66 (evm.TU.contig_36992.1)
DNA ref. Phytozome 11:   contig_36992 (2144..188)
Protein sequence: CpapPrx66 (evm.TU.contig_36992.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (292)
PWM (Da):   %s   34365.73 (31943.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.88 (8.83) Peptide Signal:   %s   cut: 25 range:25-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RLHVACLWEWCYCW*AWQRRVSRRCLLSTTTNCALKLCQPLSELWRMQSTKNVAWLLLCCVYIFMIALCRFAMLQFF*ILHLIWIVKRIXQILI*IQ*GVLKLLIGSSPRLTKFVDATWCHVQIYLLLQL*TLLSRLEGANGRYD*EGETH*VLIEH*PTLTFRLHSKTYLD*LTTSRSND*MK*PCXRSLMATP*AFLGVMSLGIESTMIQI*ILHSLKNAKRFVLXLEEMRI*VLLAKLLLNLMPLISLTY*RRRDFFILIRHFLMVALLMI*LRSIAPTLKPLHMILLIL*PRWAISIL*LGRKVQLIKIIEKX

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Stops in the frame). complement(join(188..731,1481..1676,1932..2144))
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGTCTTCACGTAGCGTGTTTGTGGGAGTGGTGCTACTGCTGGTGAGCTTGGCAGCGACGTGTTTCGCGGCGCTGTCTCCTGTCTACTACGACAAACTGTGCCCTAAAGCTTTGCCAACCA
TTAAGCGAATTGTGGAGGATGCAGTCAACCAAGAACGTCGCATGGCTGCTTCTTTGCTGCGTCTACATTTTCATGATTGCTTTGTGCAGGTTT
TCACATATATATATATATATATACATA
TGTATGTGTATAAGTTAAGAAGTACAGTTAATATTTATATTTTATTTACAGTTTGAGTTTTTTCTGAACTTTTGTACATAAATATGTAAGTTCTTTAACTTTTCTCACTGTACTAAATAC
AAACACGTACTCACAGCGCGCGCGCGCACACACACACACATATATATATATTTATGTATGAATATTGCTCTACGGGACCGGTGGTAACTTTTCTAATATTATAGGGCTGCGATGCTTCAA
TTCTTCTAGATCCTACACCTAATATGGATAGTGAAAAGAATTNNGCAAATCCTAATATAAATTCAGTGAGGGGTTTTGAAGTTATTGATCGGATCAAGTCCGAGGTTGACAAAGTTTGTG
GACGCTACGTGGTGTCATGTGCAGATATACTTGCTATTGCAGCTCTAGACTCTGTTGTCGCGGT
ACTTACTTCTTATAATTTTTATTTCTTCTTAGATGCACCATAATCATATTATCCAC
ACACACAAATATACACATCAATGAAATATAATCACCTATATGACGACTCGTTAGGAATACTTAACTGAAAATGAGTTCATGCACAAGTGCTCAATAAAGCTTACATATATTCTTTACTAA
AGAAAAAACAAAAACATGTAAAAGATGCATATTTGTGAAGTAGCTAACACAAAATTAAAACAGTTTTTGAATAAAACATGAATATTTCTACTTCCCTATGCTATTAAAATAATATGAGCA
GACAATTTGTTTTTTTTTTTTTTAAACCCAACAATTGAACAACTTTAAATTATATTTTTCTATTCATTTATTTTTTGTTTTTCCATCTAAAATTTTTTTCTTCATTTTCTCCACTCCCAT
TTCATTTCTTTTTTATTCTCCTTATAAATCCCAAACATATCTTAAGTCCCAATAATATCCTAAAGAAATGACATTGTAATTATTCTTCACCTTCTCCAATTTCCACTTTTAATTTATTGT
ATGATGGATTTCTTTAAAAAAAACTATACATTTATCAAGAAAAAGTCATTTACTTGGTAAAAAATTGACACAAATTAAGAAGAAAAAGAACAATAAGTAATGCAAGACATATAAAAGAAA
ATAAATAAAATTCGTTTGTATATATATATATATATGCATGAACATATGAAATATAACTAAATATTGAGATTAAATCTAAATAAATGTGCAGTTTGGAGGGCGCCAATGGAAGGTACGATT
AGGAAGGAGAGACTCATTAAGTGCTAATCGAGCACTAGCCAACATTAACATTCCGGCTCCATTCCAAGACTTACCTGGACTGATTGACAACTTCAAGAAGTAATGATTAAATGAAATGAC
CTTGTGNGCGCTCTCTGATGGCCACACCTTAGGCTTTTCTAGGTGTCATGTCTTTAGGGATTGAATCTACAATGATACAAATATAGATCCTACATTCGCTAAAGAACGCCAAAAGATTTG
TCCTCANGCTGGAGGAAATGAGAATTTAAGTCCTCTTGGCAAAACTCCTATTAAATTTGATGCCTCTTATTTCTTTAACCTATTAAAGAAGAAGGGACTTCTTCATTCTGATCAGGCACT
TTTTGATGGTGGCTCTACTGATGATTTAGTTAAGATCTATAGCTCCAACTTTAAAGCCTTTGCATATGATTTTGCTAATTCTATAACCAAGATGGGCAATATCAATCCTTTGACTGGGAA
GAAAGGTCCAATTGATCAAAATTATCGAAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGTCTTCACGTAGCGTGTTTGTGGGAGTGGTGCTACTGCTGGTGAGCTTGGCAGCGACGTGTTTCGCGGCGCTGTCTCCTGTCTACTACGACAAACTGTGCCCTAAAGCTTTGCCAACCA
TTAAGCGAATTGTGGAGGATGCAGTCAACCAAGAACGTCGCATGGCTGCTTCTTTGCTGCGTCTACATTTTCATGATTGCTTTGTGCAGGTTT
GCGATGCTTCAATTCTTCTAGATCCTA
CACCTAATATGGATAGTGAAAAGAATTNNGCAAATCCTAATATAAATTCAGTGAGGGGTTTTGAAGTTATTGATCGGATCAAGTCCGAGGTTGACAAAGTTTGTGGACGCTACGTGGTGT
CATGTGCAGATATACTTGCTATTGCAGCTCTAGACTCTGTTGTCGCGGT
TGGAGGGCGCCAATGGAAGGTACGATTAGGAAGGAGAGACTCATTAAGTGCTAATCGAGCACTAGCCAACA
TTAACATTCCGGCTCCATTCCAAGACTTACCTGGACTGATTGACAACTTCAAGAAGTAATGATTAAATGAAATGACCTTGTGNGCGCTCTCTGATGGCCACACCTTAGGCTTTTCTAGGT
GTCATGTCTTTAGGGATTGAATCTACAATGATACAAATATAGATCCTACATTCGCTAAAGAACGCCAAAAGATTTGTCCTCANGCTGGAGGAAATGAGAATTTAAGTCCTCTTGGCAAAA
CTCCTATTAAATTTGATGCCTCTTATTTCTTTAACCTATTAAAGAAGAAGGGACTTCTTCATTCTGATCAGGCACTTTTTGATGGTGGCTCTACTGATGATTTAGTTAAGATCTATAGCT
CCAACTTTAAAGCCTTTGCATATGATTTTGCTAATTCTATAACCAAGATGGGCAATATCAATCCTTTGACTGGGAAGAAAGGTCCAATTGATCAAAATTATCGAAAAGTCAAC

Retrieve as FASTA