Entry information : CpapPrx[P]24 (evm.model.supercontig_2.329)
Entry ID 8792
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapPrx[P]24 (evm.model.supercontig_2.329)
Name (synonym) CpapPrx[P]24 (evm.model.supercontig_2.329)
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx[P]24
start..stop
S start..stop
CpapPrx25 280 4e-95 8..176 10..197
PpePrx20 219 2e-71 5..176 6..193
CclPrx07 216 2e-70 7..176 4..192
CsPrx15 216 2e-70 7..176 4..192
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3809961..3810189 229 N° 2 3809321..3809453 133 N° 3 3809042..3809206 165 N° 4 3808740..3808888 149
complement(join(3808740..3808888,3809042..3809206,3809321..3809453,3809961..3810 189))


exon

Literature and cross-references CpapPrx[P]24 (evm.model.supercontig_2.329)
DNA ref. Phytozome 12:   supercontig_2 (3810189..3808740)
Protein sequence: CpapPrx[P]24 (evm.model.supercontig_2.329)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226 (197)
PWM (Da):   %s   24471.97 (21339.3) Transmb domain:   %s   o10-32i
PI (pH):   %s   10.56 (10.31) Peptide Signal:   %s   cut: 30 range:30-226
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPSSSLRPIILIVMLTFLVLFMGTSRAQLSKNFCAKTCPQALAAxxLKSVVRAAVAKELRMGASLLRMHFHDCFVNPNNNSLRGFEVVDAIKTKVEKLCPGMVSCANILTIAACDSVEFVRGPSWTVKLRRRDAMTTSLAAANSGVVPPPTATLDQLITRFRAQGLSARDLIALPVNERSRLKAENEGSDVEHAGMKDKWTTEIKRCLLLRTAVKRQVLKYCLF

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (frame shift in exon 1; No DAS; 3' end is missing). complement(join(3808740..3808888,3809042..3809206,3809321..3809453,3809961..3810189))
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTCCTTCTTCTTCTCTTAGACCCATTATTTTAATTGTAATGTTAACGTTTCTTGTACTCTTCATGGGCACCTCCCGTGCTCAGCTCTCTAAAAACTTCTGCGCTAAAACTTGCCCCCA
AGCCCTCGCCGCCGNNNNNTTAAAGTCTGTAGTTCGAGCTGCCGTCGCCAAAGAGCTCCGAATGGGCGCCTCTCTTCTTCGCATGCACTTTCACGACTGTTTTGTCAAT
GTAAATATTCT
TCTCTCTTTCTATCTCTCTCTCTATATATATATATATTATATAAATGAAATATGTGTATGCTTTTCGATTATAATTTTGGCAGCTTTACTTCTCAGTCTTGGGATATTGCACATGTGATA
TATGTGTCGTTGATAAACTTGTTGATATATATGATGTATAAAAGTATGGAGAAAGCCAGTGTCATTATGGCCATCCAGGATATCTATCTACTTCAATTATTAGACGACTCTGTGGTTCCC
ATATGATTGAAGATTATGTGCCATTAGTACAGTGTTCATTCAAGGGCCAAAAGCAATATGAACGACACTTGTCCATTCACAGTATTTTTTAACTGATATATAAGAAACCCAAATCAAACA
AAATCCAATAAATGTCCGTGTGCATTATATATATCACGTCAACTTCTATTTTATTTTCCTGCTTACTTTTTTCCCTTTTTTTATTTAGATAAAATGAGGTCATAAACACATGAACTCATT
ATCATAAACTGGACTTCCTAATAACAATTCTTTAAGAGGATTTGAAGTTGTTGATGCTATCAAAACAAAGGTGGAGAAATTGTGTCCTGGAATGGTTTCATGTGCTAATATTTTAACTAT
AGCAGCTTGTGATTCTGTTGAATTTGTAA
GTACATCTCTACTAATCTTACTTAAATAAATTTTTTACTTCTAGTTAGATTTTAGTTTTCAATAAAATAAATTTATTTGTTAATGATTAAT
TCTTAATTTATGTTGTAACTTAGGAGGACCTAGTTGGACAGTTAAATTAAGAAGAAGGGATGCTATGACAACTAGCCTTGCAGCTGCTAATAGTGGTGTCGTTCCTCCTCCAACAGCTAC
ACTTGACCAACTTATCACAAGATTCCGAGCTCAAGGTCTCTCTGCTAGAGACTTGATTGCATTACCTG
GTATAATTTTTTTGACTTTTTAAAGTTTATACAATATATATATATATATATT
TAAGATTTAACTCAATAAATACTTAATGATATATATTTACATGTGTGTTGTAGGTGGACATACCGTAAAAGATTGAAAATATTCTTGTTAGGGTTTTGAAGTGAATGAACGGTCAAGATT
GAAAGCAGAAAATGAAGGGTCAGATGTAGAGCACGCTGGGATGAAGGACAAGTGGACCACGGAAATTAAAAGATGCCTTCTGTTGAGAACAGCTGTAAAAAGGCAGGTTCTGAAATATTG
TTTGTTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTCCTTCTTCTTCTCTTAGACCCATTATTTTAATTGTAATGTTAACGTTTCTTGTACTCTTCATGGGCACCTCCCGTGCTCAGCTCTCTAAAAACTTCTGCGCTAAAACTTGCCCCCA
AGCCCTCGCCGCCGNNNNNTTAAAGTCTGTAGTTCGAGCTGCCGTCGCCAAAGAGCTCCGAATGGGCGCCTCTCTTCTTCGCATGCACTTTCACGACTGTTTTGTCAAT
CCTAATAACAA
TTCTTTAAGAGGATTTGAAGTTGTTGATGCTATCAAAACAAAGGTGGAGAAATTGTGTCCTGGAATGGTTTCATGTGCTAATATTTTAACTATAGCAGCTTGTGATTCTGTTGAATTTGT
AA
GAGGACCTAGTTGGACAGTTAAATTAAGAAGAAGGGATGCTATGACAACTAGCCTTGCAGCTGCTAATAGTGGTGTCGTTCCTCCTCCAACAGCTACACTTGACCAACTTATCACAAG
ATTCCGAGCTCAAGGTCTCTCTGCTAGAGACTTGATTGCATTACCTG
TGAATGAACGGTCAAGATTGAAAGCAGAAAATGAAGGGTCAGATGTAGAGCACGCTGGGATGAAGGACAAGTG
GACCACGGAAATTAAAAGATGCCTTCTGTTGAGAACAGCTGTAAAAAGGCAGGTTCTGAAATATTGTTTGTTTTAG

Retrieve as FASTA