Entry information : CpapPrx[P]27 (evm.model.supercontig_30.82)
Entry ID 8793
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapPrx[P]27 (evm.model.supercontig_30.82)
Name (synonym) CpapPrx[P]27 (evm.model.supercontig_30.82)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx[P]27
start..stop
S start..stop
LjPrx50 218 1e-70 86..235 201..349
LjPrx50 80 6e-18 27..85 41..98
MePrx118 218 2e-70 86..235 196..344
MePrx118 82 2e-18 1..85 1..93
PpePrx71 214 4e-69 86..235 202..350
PpePrx71 87 3e-20 27..85 41..99
MguPrx33 212 3e-68 84..234 179..328
MguPrx33 68 0.0000000000001 39..85 32..78
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1175806..1176060 255 N° 2 1176258..1176303 46 N° 3 1176383..1176798 416  
join(1175806..1176060,1176258..1176303,1176383..1176798)


exon

Literature and cross-references CpapPrx[P]27 (evm.model.supercontig_30.82)
DNA ref. Phytozome 11:   supercontig_30 (1175806..1176798)
Protein sequence: CpapPrx[P]27 (evm.model.supercontig_30.82)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238 (216)
PWM (Da):   %s   27126.51 (24650.2)  
PI (pH):   %s   5.78 (5.52) Peptide Signal:   %s   cut: 23 range:23-238
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSSISFLFLLLSLECLILTHSLPEPSLDIPILPDDLPFTNLLSFGYYRHSCPDLERIINRKLKHWIHKDPTLAPSLIRLHFHDCFQSNGMNVLDLVVLSGAHTIGRARCDSIQYRLFNYTGTGEADPSIDSKYFNYLSRRCRWDTEYVDLDGTTPTTFDAQYYKNLEEKKGLLQTDQMLYSDARTSPLVSAFADQPWLFHHQFGASMVKLANIQVLTDQDEDGEIRTICSSINSNNY

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (exon 2 and 3 are missing due to nnnnn in DNA sequence).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCCTCCATTTCTTTTCTCTTTCTCCTCCTTTCTCTTGAGTGCTTAATCCTAACACACTCTCTTCCTGAACCTTCTCTAGATATCCCCATATTGCCAGATGATTTGCCTTTCACT
AATCTACTCTCCTTCGGTTACTATCGCCATAGCTGTCCAGATCTTGAAAGGATCATCAACAGAAAACTAAAGCACTGGATCCACAAGGATCCCACTCTCGCACCCAGTCTCATCAGATTG
CACTTCCACGACTGC
GCCGTTACGGTATTATATATCTACATGCACACAATATATAATCCAATTACATCAAGACTAACACACATATCTATATGTACCTTCCTTTCATTTATTTCTTTTATA
TTCAACAAATTATTTCAAAATTTTGAACTGATAGAAAAGTGATTAACTAATTATTTATGTTCTAANNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCAATCCAATGGAATGAACGTTCTTG
ATTTAGTTGTCCTATCAG
GTGCATTATATAATCCCATTGAAATATATTTTTTTGATCCATTTAAAATGAATTTATATATGATAGTTTGGATTTTCAGGGGCACATACAATTGGAAGAGCA
AGATGTGATTCAATCCAGTACAGACTCTTTAACTACACTGGAACCGGTGAAGCTGATCCATCCATTGATTCCAAGTACTTCAACTACTTGTCGAGAAGATGCAGATGGGATACTGAATAT
GTTGACTTAGATGGGACAACTCCGACAACCTTTGACGCTCAATATTACAAGAATCTTGAGGAAAAAAAGGGACTTTTACAGACAGATCAAATGCTGTATTCTGATGCCAGGACTTCTCCT
CTTGTTTCTGCTTTTGCTGATCAGCCATGGCTATTTCACCACCAGTTTGGAGCGTCAATGGTGAAGCTTGCCAACATTCAGGTCCTCACTGATCAAGATGAAGATGGAGAAATTCGAACT
ATTTGCTCTTCTATTAACTCTAACAACTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCCTCCATTTCTTTTCTCTTTCTCCTCCTTTCTCTTGAGTGCTTAATCCTAACACACTCTCTTCCTGAACCTTCTCTAGATATCCCCATATTGCCAGATGATTTGCCTTTCACT
AATCTACTCTCCTTCGGTTACTATCGCCATAGCTGTCCAGATCTTGAAAGGATCATCAACAGAAAACTAAAGCACTGGATCCACAAGGATCCCACTCTCGCACCCAGTCTCATCAGATTG
CACTTCCACGACTGC
TTTCAATCCAATGGAATGAACGTTCTTGATTTAGTTGTCCTATCAGGGGCACATACAATTGGAAGAGCAAGATGTGATTCAATCCAGTACAGACTCTTTAACTAC
ACTGGAACCGGTGAAGCTGATCCATCCATTGATTCCAAGTACTTCAACTACTTGTCGAGAAGATGCAGATGGGATACTGAATATGTTGACTTAGATGGGACAACTCCGACAACCTTTGAC
GCTCAATATTACAAGAATCTTGAGGAAAAAAAGGGACTTTTACAGACAGATCAAATGCTGTATTCTGATGCCAGGACTTCTCCTCTTGTTTCTGCTTTTGCTGATCAGCCATGGCTATTT
CACCACCAGTTTGGAGCGTCAATGGTGAAGCTTGCCAACATTCAGGTCCTCACTGATCAAGATGAAGATGGAGAAATTCGAACTATTTGCTCTTCTATTAACTCTAACAACTACTAG

Retrieve as FASTA