Entry information : CpapPrx[P]36 (evm.model.supercontig_45.48)
Entry ID 8794
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapPrx[P]36 (evm.model.supercontig_45.48)
Name (synonym) CpapPrx[P]36 (evm.model.supercontig_45.48)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx[P]36
start..stop
S start..stop
GhPrx12 196 2e-64 1..139 2..143
GhPrx24 186 4e-62 18..138 19..142
BrPrx21-1Ab_other 192 4e-62 8..139 9..143
BstrPrx19 191 9e-62 1..139 1..142
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1337763..1337834 72 N° 2 1337525..1337668 144 N° 3 1337241..1337441 201  
complement(join(1337241..1337441,1337525..1337668,1337763..1337834))


exon

Literature and cross-references CpapPrx[P]36 (evm.model.supercontig_45.48)
DNA ref. Phytozome 11:   supercontig_45 (1337834..1337241)
Protein sequence: CpapPrx[P]36 (evm.model.supercontig_45.48)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   137 (109)
PWM (Da):   %s   15782.85 (12412.1) Transmb domain:   %s   i7-24o
PI (pH):   %s   6.34 (4.88) Peptide Signal:   %s   cut: 29 range:29-137
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATQNRHCCITFIFLLLQLIFHFHKSDLELNYYAENCPRT*EIIKQEVVKLYYKHGNTVVSWVRNLFHD*VVSCDASLLLETMNGIESEQESGRSFGMRNFKYVKTIKDAQEKECPLTVSCADIVALFARDDIIMVCFP

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (stop in frame, end exon 3 and exon 4 are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCCAAAACCGCCATTGTTGCATTACCTTCATCTTTCTGTTATTACAATTGATCTTCCACTTTCATATTGGTACATACTCATATATCATTCTATGATATATATATATATATATA
TATATATATGCGTGTAGATCAATCTTCAGTTTGTGATTGTGCAGGTAAAAGTGATCTGGAGTTGAATTATTACGCAGAGAATTGTCCAAGAACTTAGGAGATCATCAAACAAGAAGTCGT
AAAGCTTTATTATAAACATGGAAATACTGTTGTTTCTTGGGTCAGAAATCTATTCCACGATTGAGTAGTT
AACGTACAGATCTACAGATATTTATATATATAAATATAAATACATATATA
TATTAGATTATGTATGAATATTTTGATGTGTAGTCATGCGATGCATCCTTATTGTTGGAGACAATGAATGGGATAGAATCAGAGCAGGAATCTGGAAGAAGCTTTGGCATGAGAAACTTC
AAGTATGTTAAAACAATCAAAGATGCCCAAGAAAAGGAATGCCCGCTCACCGTCTCTTGTGCTGATATTGTTGCTCTCTTTGCTAGAGATGACATCATCATGGTATGTTTTCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCCAAAACCGCCATTGTTGCATTACCTTCATCTTTCTGTTATTACAATTGATCTTCCACTTTCATAAAAGTGATCTGGAGTTGAATTATTACGCAGAGAATTGTCCAAGAACT
TAGGAGATCATCAAACAAGAAGTCGTAAAGCTTTATTATAAACATGGAAATACTGTTGTTTCTTGGGTCAGAAATCTATTCCACGATTGAGTAGTT
TCATGCGATGCATCCTTATTGTTG
GAGACAATGAATGGGATAGAATCAGAGCAGGAATCTGGAAGAAGCTTTGGCATGAGAAACTTCAAGTATGTTAAAACAATCAAAGATGCCCAAGAAAAGGAATGCCCGCTCACCGTCTCT
TGTGCTGATATTGTTGCTCTCTTTGCTAGAGATGACATCATCATGGTATGTTTTCCT

Retrieve as FASTA