Entry information : CsaAPx03 (Cucsa.043770.1)
Entry ID 8797
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-11 (Christophe Dunand)
Peroxidase information: CsaAPx03 (Cucsa.043770.1)
Name (synonym) CsaAPx03 (Cucsa.043770.1)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaAPx03
start..stop
S start..stop
LeAPx06 396 2e-140 1..268 1..262
MtAPx05 394 7e-140 1..284 1..280
GmAPx06 394 1e-139 1..284 1..275
PtAPx05 391 2e-138 1..256 1..253
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 456144..456256 113 N° 2 455200..455324 125 N° 3 454945..454994 50 N° 4 454420..454485 66
N° 5 454283..454331 49 N° 6 453749..453831 83 N° 7 453583..453662 80 N° 8 453366..453477 112
N° 9 452935..453150 216  
complement(join(452935..453150,453366..453477,453583..453662,453749..453831,4542 83..454331,454420..454485,454945..454994,455200..455324,456144..456256))


exon

Literature and cross-references CsaAPx03 (Cucsa.043770.1)
DNA ref. Phytozome 12:   scaffold00542 (456256..452935)
Protein sequence: CsaAPx03 (Cucsa.043770.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   297
PWM (Da):   %s   32685.96 Transmb domain:   %s   i263-285o
PI (pH):   %s   9.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPNVDAVYLKEIEKARRDLRALIFKEKCAPIMLRLAWHDAGSYDAKTKTGGPNGSIRFMNELNHTANKGLKIAVDFETVKTRHPKITYADLYLAGVVAVEITGGPPIDFVPGRKDANAAIEEGRLPDGHKGASHLRDVFYRMGLTDKDIVALSGGHTGRAHKDRSDFEGPWTKDFLKFDNSYFVELLKNDSRSGDQLLKLPTDKALVTDSQFSQYVREYADEDKFFTDYAASHKKLSELGFTKPSTVLNGKGCAWKNGIVVAVIIAVVGIILSYNRGILPQGGNAFQLNLF*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTCCCAACGTCGATGCTGTGTACCTGAAGGAAATCGAGAAGGCCCGTCGAGACCTCCGTGCTTTAATCTTCAAAGAGAAATGCGCTCCCATTATGCTCCGTTTAGCGTAAGTT
TTTGTTCTAAGTTCTATATTTGTGATTGTTTATAGATTTGCAGGGGAAAGTGAAATAAATTGAACACCGCATCTGCTTGGGAAATTATTTCGCATTTTGTTTTTCTATCATTGCACAGTT
GATTGGGTGTTTTAGTTGATGAGTTCAAAATCAATATGAAATGTCCATTTAGTCATCAAATAATATTTTGTCGGGTTCCAAACACGTTTGATTCTTGAGCTTTTAGTGAGTGACAATGAA
CTTTAGTCAGTAAAGTTTTAGTATTTGTAATTTTAACTTTGCAACAATATAGTCCTTTCAACTCTAATAACTGATCATCTAGTTGGTATACTTTTCAATTTGTAAGGATTAGTCCTTCAC
ATGTAAACTATTGTTAGATTTAATGAAATATTTTATGCATGTAGATTGATAATGTGACCAAGGATAAGCTTTGTTTATAAACTATGGAAAATGTTGTTAGGCAATAAAAAATAACACTTA
ATTCTGATATGGTTTATTATGGTGGGTTAAAATTATTACAAATTTGAAAGTATAGAGACTAAGTTCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAATTTGTAGAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNAGCATGATAAAAGTGATATCATTAAAATCACTCTCAAACATGCTTGGAATTCATTTGTTGAAGAGGGATTTTTGTTGGGTAGGTGGCATGATGCTGGTAGCTATGACGCT
AAAACGAAAACCGGAGGTCCCAATGGCTCCATCAGGTTCATGAATGAATTGAACCATACTGCAAATAAAGGACTCAAAATCGCAGTTGATTTCTGTG
GTAAGTTCTTTTATTTATTTTAA
TCTTTCTTTATTGTGAAGTCTATCTTATAGAGAAGAATTAATGTCTTTCTTCAAATGTTAGTTTCAGTGTAATGACAAAATTAATTAGTCTCTCCCAACTGATATGATTGTCTGGGGATT
TGATTTGATTTGCTTTGGTAGACATTTTTACTTATTCTTCCTTTTGTTGTGCCATTCAACAGAAACTGTGAAGACCAGACATCCAAAAATCACATATGCAGATCTGTACCAGGTGATCTT
CCCTTTGTTGGAAATTGCCCCTTTTGGACTATTTCTTTCTTCCAGTTTTCCTTGTCATTCATTGACATAATTTATGGCATTCTCCTTTCTCAAATTTAGAAGTGGGAGGCAGATTCTTTN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAACTCCCACAGTTCTTCACCTTCTATTCGTGCTCGTCGCTTCAATCATTTGGG
AAATACAAAACTTTCAAAGTTTAAGAACCTAATAAAGTAAAGTTTCATCTATCAAGATGTGGCTCATTCTCCTCCAATTGTAAATTTTCAGCTTGCTGGAGTTGTTGCTGTGGAGATTAC
TGGCGGGCCACCCATTGACTTTGTCCCCGGAAGAAAG
GTATACCTCATACACAAAAAAATTCGATAGATTGACAATTGGTATTGCCGTTGAACAACTTCATTCTTCTTTTACATCAATGG
ATTAGGACGCAAATGCAGCTATAGAAGAAGGCCGCCTTCCAGATGGCCACAAAGGTGACTTTTTGTTAAGACTGTAGATATAATAACTTCATTGGTAGTTTATTGATAACCCAACTTCTA
AAATATTATTCTCTATTTTAGTCCTTAAATATTAAATATAACTATAAATGTTTATCTTAGTATCTGAAATTTGTAAAACAACTACATTGGGGATGGCTAATTTTTCCATGTAATCGTTAC
TCACAACAGCATGTTTGTACATATATCGAAGTTACCTTAAGTTATGAACAGACGTTTTTTTTCCTATAACTAAAATGGTCCTTTTGAAAATGTTAATTAAAGAAATGAGATACAAACCTT
TAATAATGTTAGGTATTTAAACTTCTTGCTATTTTCAATTCCACAAATGAAAAGGCGGTTTGAGATTTTGGAGTGTCTGGAACTTTTCTTCTTCGAAGTTATAGCAGAAGCCATGATTGA
TTGGTCATTACATTCTTCACTGCAGGTGCTTCCCATTTAAGAGATGTATTTTACAGGATGGGACTAACTGACAAGGATATTGTGGCATTATCTGGCGGACACACATTGGTACTTTCTCTT
GCTTTTTGTTTCTTTCAACTATGAAGAAATTGGATCTTCACCTTTGTCTTTATCTTTTTCTTTTCATCAACCAGGGAAGAGCTCACAAGGACAGATCAGATTTTGAAGGCCCATGGACAA
AGGACTTTCTGAAGTTTGATAACTCCTACTTTGT
GTGAGAATGACAGAAAAAAACATCTCCTCACTTCATTTTATATGCATTCAATTTCCTTTTGCTTGTAGATAAAAAAAGTTCTCACC
CAAATGTAATTTTGTTCAGGGAATTGCTGAAAAATGACTCTCGATCTGGGGATCAACTGTTGAAGCTTCCTACAGACAAGGCCTTGGTCACAGATTCTCAGTTTTCCCAATATGTGAGGG
AATACGCAAAG
GTGAACTTCTGCTACTATGATTTTATCATTTAGGGCATGTACGAGATTGATTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGAAACCCTTCTTTTAACTTAGAGGATTTTATGTTTTTCTTTCCAATAGGATGAAGACAAGTT
TTTCACGGATTATGCAGCATCTCACAAGAAACTGTCTGAGCTTGGCTTCACTAAACCTTCCACAGTTCTCAATGGCAAAGGCTGTGCTTGGAAAAACGGAATTGTGGTAGCTGTGATCAT
AGCAGTTGTGGGGATAATACTGAGTTACAATAGAGGCATTTTGCCTCAGGGGGGGAATGCCTTTCAACTAAATCTATTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTCCCAACGTCGATGCTGTGTACCTGAAGGAAATCGAGAAGGCCCGTCGAGACCTCCGTGCTTTAATCTTCAAAGAGAAATGCGCTCCCATTATGCTCCGTTTAGCGTGGCAT
GATGCTGGTAGCTATGACGCTAAAACGAAAACCGGAGGTCCCAATGGCTCCATCAGGTTCATGAATGAATTGAACCATACTGCAAATAAAGGACTCAAAATCGCAGTTGATTTCTGTG
AA
ACTGTGAAGACCAGACATCCAAAAATCACATATGCAGATCTGTACCAG
CTTGCTGGAGTTGTTGCTGTGGAGATTACTGGCGGGCCACCCATTGACTTTGTCCCCGGAAGAAAGGACGCA
AATGCAGCTATAGAAGAAGGCCGCCTTCCAGATGGCCACAAAG
GTGCTTCCCATTTAAGAGATGTATTTTACAGGATGGGACTAACTGACAAGGATATTGTGGCATTATCTGGCGGACAC
ACATTG
GGAAGAGCTCACAAGGACAGATCAGATTTTGAAGGCCCATGGACAAAGGACTTTCTGAAGTTTGATAACTCCTACTTTGTGGAATTGCTGAAAAATGACTCTCGATCTGGGGAT
CAACTGTTGAAGCTTCCTACAGACAAGGCCTTGGTCACAGATTCTCAGTTTTCCCAATATGTGAGGGAATACGCAAAG
GATGAAGACAAGTTTTTCACGGATTATGCAGCATCTCACAAG
AAACTGTCTGAGCTTGGCTTCACTAAACCTTCCACAGTTCTCAATGGCAAAGGCTGTGCTTGGAAAAACGGAATTGTGGTAGCTGTGATCATAGCAGTTGTGGGGATAATACTGAGTTAC
AATAGAGGCATTTTGCCTCAGGGGGGGAATGCCTTTCAACTAAATCTATTCTGA

Retrieve as FASTA