Entry information : CsaPrx11 (Cucsa.000240.1)
Entry ID 8805
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx11 (Cucsa.000240.1)
Name (synonym) CsaPrx11 (Cucsa.000240.1)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx11
start..stop
S start..stop
CsaPrx10 566 0 1..320 1..320
PtPrx39 447 1e-159 9..320 7..319
PpePrx43 444 1e-158 5..320 4..320
PpePrx54 443 4e-158 8..320 9..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24599..24811 213 N° 2 24311..24505 195 N° 3 23443..23997 555  
complement(join(23443..23997,24311..24505,24599..24811))


exon

Literature and cross-references CsaPrx11 (Cucsa.000240.1)
DNA ref. Phytozome 12:   scaffold00009 (24811..23443)
Protein sequence: CsaPrx11 (Cucsa.000240.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (296)
PWM (Da):   %s   34533.23 (31997.8)  
PI (pH):   %s   7.45 (7.36) Peptide Signal:   %s   cut: 25 range:25-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLVHSLLLCVLVLSASLIHTHAQLTSNFYNNVCPKALSTIKSVVLNAIKNEPRMGASLLRLHFHDCFVNGCDGSVLLDDTSTFTGEKTALPNANSIRGFEVIDQIKTQVNQACNGNLVSCADILAVAARDSVAILGGPNYKVLVGRRDARTTSVNDANRNLPPPFFNVTQLLSNFQSHGLDLKDLVVLSAGHTLGYARCTSFRNRIYNDTNIDSKFAATLQGNCPQSGGDDNLSGLDKTPYSFDNAYFKFLLSNKGLLHSDQELFGGGNGDSDNLVKYYSTYPNAFKNDFASSMIKMGNMNPLTGSDGEVRANCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCCCTCGTTCACTCTCTTTTGCTTTGTGTTCTTGTTTTATCAGCTTCCCTAATTCATACCCATGCACAACTAACTTCTAACTTTTACAACAATGTGTGCCCTAAGGCCTTGTCC
ACCATTAAGTCGGTCGTTTTGAATGCCATAAAAAACGAGCCTCGAATGGGAGCTTCACTCTTACGTCTCCATTTCCACGATTGCTTTGTCAAT
GTAAGTTGATCATTAATTTTTCGTATT
TGTTGATCTCATTGAATTCTTTGTTCACATTTTAATTTCTATGTGTTTTGATAATATAATTGTTAGGGTTGTGATGGATCGGTCTTGTTAGATGATACTTCTACTTTCACTGGAGAAAAG
ACTGCACTTCCTAATGCTAATTCGATAAGAGGATTTGAAGTTATTGACCAGATTAAGACACAAGTCAACCAAGCTTGCAATGGCAATCTTGTGTCTTGTGCTGATATTTTAGCCGTTGCT
GCTCGGGACTCTGTTGCTATC
GTAAGTTATATATCTTCCTTTTAAATTTACCATCAAAATTTAATCGATAGGTTACTTACAACCACTGACAAATTTAGTATAGGTCAATATAGAGACTTA
CATACATACATGTGTACATGTTAGTATTGTATGTAAAACTAAATTATTACCTATTCCAGTAGATGGTTAGTGGTTAACTTGTCCACCAACATTGTTTCCAAATTATTGAGCTGCCAACTA
CTTATAGCATATACTAGGTATCAAACGTATGGTTTAGGGTTGAGTTATATATGTTCAAGTTGACTCATGTCTTAATTAAGTTTTGGTGTTTTAGCTTGGAGGACCAAACTACAAAGTACT
AGTAGGAAGAAGAGATGCAAGAACAACGAGTGTAAACGATGCCAACAGAAATCTTCCTCCACCATTTTTCAACGTCACACAGCTTCTTTCCAACTTCCAATCTCATGGCCTCGACCTCAA
GGACCTCGTCGTCTTGTCGGCTGGCCACACTCTTGGGTATGCTCGGTGTACCAGTTTTCGAAATAGGATATACAATGACACCAACATCGACTCGAAATTTGCAGCGACATTGCAGGGAAA
CTGCCCACAAAGCGGTGGTGATGACAATCTAAGTGGCCTTGACAAGACTCCATATTCATTTGACAATGCCTACTTCAAGTTTTTGTTGAGCAACAAGGGTCTTCTCCACTCCGACCAAGA
ACTCTTCGGCGGTGGGAACGGCGACAGTGATAATTTGGTGAAATATTATAGCACATACCCAAATGCATTCAAAAATGATTTTGCTTCTTCCATGATCAAAATGGGGAATATGAATCCACT
TACCGGAAGTGACGGAGAAGTCAGAGCCAATTGCAGAGTTGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCCCTCGTTCACTCTCTTTTGCTTTGTGTTCTTGTTTTATCAGCTTCCCTAATTCATACCCATGCACAACTAACTTCTAACTTTTACAACAATGTGTGCCCTAAGGCCTTGTCC
ACCATTAAGTCGGTCGTTTTGAATGCCATAAAAAACGAGCCTCGAATGGGAGCTTCACTCTTACGTCTCCATTTCCACGATTGCTTTGTCAAT
GGTTGTGATGGATCGGTCTTGTTAGAT
GATACTTCTACTTTCACTGGAGAAAAGACTGCACTTCCTAATGCTAATTCGATAAGAGGATTTGAAGTTATTGACCAGATTAAGACACAAGTCAACCAAGCTTGCAATGGCAATCTTGTG
TCTTGTGCTGATATTTTAGCCGTTGCTGCTCGGGACTCTGTTGCTATC
CTTGGAGGACCAAACTACAAAGTACTAGTAGGAAGAAGAGATGCAAGAACAACGAGTGTAAACGATGCCAAC
AGAAATCTTCCTCCACCATTTTTCAACGTCACACAGCTTCTTTCCAACTTCCAATCTCATGGCCTCGACCTCAAGGACCTCGTCGTCTTGTCGGCTGGCCACACTCTTGGGTATGCTCGG
TGTACCAGTTTTCGAAATAGGATATACAATGACACCAACATCGACTCGAAATTTGCAGCGACATTGCAGGGAAACTGCCCACAAAGCGGTGGTGATGACAATCTAAGTGGCCTTGACAAG
ACTCCATATTCATTTGACAATGCCTACTTCAAGTTTTTGTTGAGCAACAAGGGTCTTCTCCACTCCGACCAAGAACTCTTCGGCGGTGGGAACGGCGACAGTGATAATTTGGTGAAATAT
TATAGCACATACCCAAATGCATTCAAAAATGATTTTGCTTCTTCCATGATCAAAATGGGGAATATGAATCCACTTACCGGAAGTGACGGAGAAGTCAGAGCCAATTGCAGAGTTGTCAAT
TAA

Retrieve as FASTA