Entry information : CsaPrx25 (Cucsa.087770.2)
Entry ID 8815
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx25 (Cucsa.087770.2)
Name (synonym) CsaPrx25 (Cucsa.087770.2)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx25
start..stop
S start..stop
VvPrx65 468 8e-168 15..330 4..322
CclPrx43 467 2e-167 13..330 4..324
CsPrx20 465 2e-166 13..330 6..326
HaPrx08 461 6e-165 9..330 6..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 315224..315460 237 N° 2 315920..316111 192 N° 3 316194..316754 561  
join(315224..315460,315920..316111,316194..316754)


exon

Literature and cross-references CsaPrx25 (Cucsa.087770.2)
DNA ref. Phytozome 11:   scaffold00888 (315224..316754)
Protein sequence: CsaPrx25 (Cucsa.087770.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (298)
PWM (Da):   %s   35571.01 (31746.0) Transmb domain:   %s   i13-30o
PI (pH):   %s   8.57 (8.21) Peptide Signal:   %s   cut: 33 range:33-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDEFGGGRRRRRMRWFLVFIILMGIFVEIGEGQLVKNFYKSTCPNVEQIVTQAVRNKFSQTIITISATLRLFFHDCFVEGCDASVMIASPTGDAEKDAQDNLSLAGDGFDTVVKAKQAVEAACPGRASCADILALAARDVVVLAGGPNFNVELGRRDGLISKASRVDGNLPSPNFDLNSLTSMFAKHGLSQTDMIALSGAHTIGASHCNRFSDRLFSDSGVDPSLNPGYAEELKQACPRNVDPGVVVKLDPTTPDSFDNAYYRNLVEGKGLFRSDEVLFTNSASKGRVVGFANNKGKFNGAFVKAMRKLGRVGVKTGKAGEIRRDCTAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGAATTTGGAGGAGGAAGAAGAAGAAGAAGAATGCGTTGGTTTTTGGTGTTCATCATTTTAATGGGGATTTTTGTAGAAATAGGTGAAGGGCAGTTGGTGAAAAACTTTTATAAG
TCGACTTGTCCAAACGTGGAACAAATTGTGACACAAGCTGTTCGAAACAAGTTCTCTCAAACTATCATTACCATCTCTGCTACTCTCCGTCTCTTCTTCCATGATTGCTTTGTTGAG
GTA
TTCATAACTCTATATATCATATACTTCTTAATATATATAGTTTAACCATCCTAAAAGTGAGAAAATGTTTAGTGTCTTCTACTTCTATATAACTAATTCTTTCTCATTTTAGTAAATGGT
TGGCTACTTGTTTTAAACATTTTTTAGGTTAATCATAAGTTCCCTCTATTTTTAAAAGATTAGAAATCATTTTTGGTATTGGTTTTAGTATATTGAGATAAAATAATTTTTTTAAATCAA
ATTTGACCTTGATTTTTTATTTCATCCAACTATAGATTATACAATGTTGTTTTATAATTTATGTTGTATGTTATGATTTCTGTATTCTTATTATATTAATTTCTTTGGAAAGAATTGTTT
TGGTTTTGTTTGTTTGTTTGTTTTACTCATTATTTAGGGTTAGATTTATTAAATTTCTGGATATTATGCATTGGTTGGGTTTCCTGGTGACGGGAGGGATGTGATGCTTCTGTCATGATT
GCATCGCCAACCGGAGACGCCGAGAAGGACGCTCAAGATAACCTTTCCCTCGCCGGAGATGGCTTCGACACCGTCGTCAAGGCTAAGCAAGCCGTCGAAGCCGCATGCCCCGGTCGAGCC
TCTTGCGCCGACATTCTGGCTCTCGCCGCCAGAGACGTCGTCGTCCTC
GTAAGTCTCTCCATCATATTCATGCATGGTCACGTACAGTTTCAATTAAATCCAAAATTAAACCCAATTCCC
ATCTCCACAGGCCGGAGGCCCAAATTTCAACGTCGAATTAGGACGTCGCGACGGTTTAATCTCGAAAGCCTCACGCGTCGACGGCAATTTACCATCCCCAAATTTCGACCTAAACTCACT
GACCTCCATGTTCGCGAAACACGGGCTCTCCCAAACCGACATGATCGCCCTCTCGGGCGCCCACACAATCGGCGCCTCCCACTGTAACCGGTTCTCGGACCGACTCTTCTCTGATTCGGG
TGTAGATCCGTCGCTAAACCCTGGTTACGCAGAAGAGCTGAAGCAAGCGTGCCCTCGGAATGTAGATCCAGGGGTGGTGGTGAAGCTGGATCCGACTACTCCGGACAGTTTCGACAATGC
ATATTACAGAAATCTGGTGGAGGGAAAAGGATTGTTTAGATCAGATGAGGTTCTGTTCACGAACTCGGCGTCGAAGGGGAGGGTGGTGGGGTTTGCGAATAACAAGGGGAAGTTTAATGG
GGCGTTTGTGAAGGCTATGAGGAAGCTTGGGAGAGTGGGGGTTAAGACGGGGAAGGCTGGAGAGATAAGAAGAGATTGTACTGCTTTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGAATTTGGAGGAGGAAGAAGAAGAAGAAGAATGCGTTGGTTTTTGGTGTTCATCATTTTAATGGGGATTTTTGTAGAAATAGGTGAAGGGCAGTTGGTGAAAAACTTTTATAAG
TCGACTTGTCCAAACGTGGAACAAATTGTGACACAAGCTGTTCGAAACAAGTTCTCTCAAACTATCATTACCATCTCTGCTACTCTCCGTCTCTTCTTCCATGATTGCTTTGTTGAG
GGA
TGTGATGCTTCTGTCATGATTGCATCGCCAACCGGAGACGCCGAGAAGGACGCTCAAGATAACCTTTCCCTCGCCGGAGATGGCTTCGACACCGTCGTCAAGGCTAAGCAAGCCGTCGAA
GCCGCATGCCCCGGTCGAGCCTCTTGCGCCGACATTCTGGCTCTCGCCGCCAGAGACGTCGTCGTCCTC
GCCGGAGGCCCAAATTTCAACGTCGAATTAGGACGTCGCGACGGTTTAATC
TCGAAAGCCTCACGCGTCGACGGCAATTTACCATCCCCAAATTTCGACCTAAACTCACTGACCTCCATGTTCGCGAAACACGGGCTCTCCCAAACCGACATGATCGCCCTCTCGGGCGCC
CACACAATCGGCGCCTCCCACTGTAACCGGTTCTCGGACCGACTCTTCTCTGATTCGGGTGTAGATCCGTCGCTAAACCCTGGTTACGCAGAAGAGCTGAAGCAAGCGTGCCCTCGGAAT
GTAGATCCAGGGGTGGTGGTGAAGCTGGATCCGACTACTCCGGACAGTTTCGACAATGCATATTACAGAAATCTGGTGGAGGGAAAAGGATTGTTTAGATCAGATGAGGTTCTGTTCACG
AACTCGGCGTCGAAGGGGAGGGTGGTGGGGTTTGCGAATAACAAGGGGAAGTTTAATGGGGCGTTTGTGAAGGCTATGAGGAAGCTTGGGAGAGTGGGGGTTAAGACGGGGAAGGCTGGA
GAGATAAGAAGAGATTGTACTGCTTTCAAT

Retrieve as FASTA