Entry information : CsaPrx27 (Cucsa.087780.1[1.0])
Entry ID 8816
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-11 (Achraf Jemmat)
Peroxidase information: CsaPrx27 (Cucsa.087780.1[1.0])
Name (synonym) CsaPrx27 (Cucsa.087780.1[1.0])
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx27
start..stop
S start..stop
VvPrx65 513 0 7..331 4..323
NtPrx44-1A 503 0 28..331 22..325
LePrx38 502 0 28..331 22..325
CclPrx43 502 0 24..330 18..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 319217..319444 228 N° 2 320129..320320 192 N° 3 320437..321012 576  
join(319217..319444,320129..320320,320437..321012)


exon

Literature and cross-references CsaPrx27 (Cucsa.087780.1[1.0])
DNA ref. Phytozome 11:   scaffold00888 (319217..321009)
Protein sequence: CsaPrx27 (Cucsa.087780.1[1.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (312)
PWM (Da):   %s   35667.66 (33470.4)  
PI (pH):   %s   4.51 (4.38) Peptide Signal:   %s   cut: 30 range:20-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLRFLWKGLVLAVVVAWAATGTVKRGEAQLVENFYGSNCPNLEQIVTQSVQTKFAQTFVTIPATLRLFFHDCFVEGCDASVLIASLNGDAEKDAKDNLSLAGDGFDTVVKAKQAVENVCPGLVSCADILALATRDVVNLAGGPQYSVELGRRDGLISQASRVAGNLPEPFFDLNQLTNMFAAHNLTLIDMIALSGAHTQGFSHCDRFANRLYSFSPSSPTDPSLDPEYARQLMDACPQNVDPSVAINMDPITPQTFDNVYYQNLISGKGLFTSDQILFTESESQPTVSSFATNGAEFNAAFITAMTKLGRVGVKTGNDGEIRRDCTAFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGATTGAGGTTTCTTTGGAAAGGTTTGGTTTTAGCAGTGGTTGTTGCGTGGGCGGCGACGGGGACGGTGAAGAGAGGGGAGGCGCAATTAGTTGAAAATTTCTATGGCTCAAATTGC
CCAAACTTAGAGCAAATCGTTACGCAATCTGTTCAAACCAAATTTGCTCAAACTTTTGTTACAATTCCCGCAACTTTGAGACTCTTCTTCCATGATTGCTTTGTCGAG
GTATTACTTCTT
CTTCTTTCTTCTTATTGATGCTTTTTAAAAATTAAATTTTAGGCGAGATATATCCTAATGTAAATGATGTTTTTCACATAAAATGTCTATATCTGTTTCTAAATCAAAGTTTTTTTTCGT
AGTACTATCAAGATATCATATTCTCTTTGTTCACGTTATAAATTTGTTTTCATTTATGTCAGTGAACAAAAAGGAGAGTTTGATTCTTTTTCGTGATACAAAATTATATAAACAATTGTT
TGAAAGTTTGAACTTTGTACGACTTTGAAAGTATGGTTAGTTTTTTTTTAATATTAGAATATTGGTGTGGTTCATAATCAAGTAAATTGAGCAAAAGAGAAGAAATTTTAGTGATACCAA
CTTATTTAGCAAAAGAGAAGAAATTTTAGTCAGAAACCAACTTATTTAGTAAAGTACCTAAACAATTTGACTTGGAGGAGTTGGAGCTAACCAAATAAGAACAAACTTCTTACTTTTATG
TATAACTATATATGTTGAAAAACTTGCACCTTTGGTTATCTTTCATCTCACTCCACATTTTCACACATTTGATTGAGGGTTGGGGGGTTTTCTTTGAAGTACAAACTAGTTTTCAGATAG
TTGATATAGTAAAGAGGTCGATAACAGTAATTTGAATTTTACTTTGTTTTCTTTTGAATGGAATGTGTGTAGGGATGCGATGCTTCAGTGTTGATAGCTTCTCTAAATGGAGATGCAGAG
AAAGATGCAAAAGACAATCTTTCATTAGCGGGAGATGGATTTGACACCGTTGTTAAAGCAAAGCAAGCTGTTGAAAATGTTTGTCCTGGTCTCGTTTCTTGTGCTGACATCTTGGCTCTT
GCAACTAGAGATGTTGTTAACTTG
GTAGGTAACAAGTAACATGCATCGTCCTATATTTGAAATGTTGTTTAAAATATGTTGATTTGATATTTTGTTTATATCAATACAAATATCTAAAAG
TCATTGTTCTTGTGTTTCAGGCAGGAGGTCCACAATATAGTGTGGAACTTGGACGTAGAGATGGGCTTATTTCTCAAGCATCTCGAGTGGCAGGAAACCTACCAGAACCATTCTTCGATC
TGAACCAACTAACAAACATGTTTGCCGCCCACAACCTAACCCTAATCGATATGATCGCCCTTTCTGGAGCCCACACCCAGGGATTCTCCCACTGTGACCGTTTCGCAAATCGCCTTTACT
CATTTTCACCTTCTTCTCCAACGGACCCATCGTTGGACCCCGAGTACGCACGGCAGCTAATGGATGCTTGTCCGCAGAATGTGGATCCCAGTGTGGCCATCAACATGGACCCTATAACTC
CTCAGACCTTTGACAACGTTTATTATCAAAACCTCATCTCTGGCAAAGGCTTATTCACTTCCGATCAGATTCTGTTTACCGAGTCTGAATCACAACCAACAGTTAGTAGTTTTGCCACCA
ATGGAGCAGAGTTTAATGCAGCGTTTATCACAGCCATGACCAAGTTAGGTCGAGTTGGGGTTAAGACCGGTAATGATGGTGAAATTCGAAGGGATTGCACTGCCTTTAATTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGATTGAGGTTTCTTTGGAAAGGTTTGGTTTTAGCAGTGGTTGTTGCGTGGGCGGCGACGGGGACGGTGAAGAGAGGGGAGGCGCAATTAGTTGAAAATTTCTATGGCTCAAATTGC
CCAAACTTAGAGCAAATCGTTACGCAATCTGTTCAAACCAAATTTGCTCAAACTTTTGTTACAATTCCCGCAACTTTGAGACTCTTCTTCCATGATTGCTTTGTCGAG
GGATGCGATGCT
TCAGTGTTGATAGCTTCTCTAAATGGAGATGCAGAGAAAGATGCAAAAGACAATCTTTCATTAGCGGGAGATGGATTTGACACCGTTGTTAAAGCAAAGCAAGCTGTTGAAAATGTTTGT
CCTGGTCTCGTTTCTTGTGCTGACATCTTGGCTCTTGCAACTAGAGATGTTGTTAACTTG
GCAGGAGGTCCACAATATAGTGTGGAACTTGGACGTAGAGATGGGCTTATTTCTCAAGCA
TCTCGAGTGGCAGGAAACCTACCAGAACCATTCTTCGATCTGAACCAACTAACAAACATGTTTGCCGCCCACAACCTAACCCTAATCGATATGATCGCCCTTTCTGGAGCCCACACCCAG
GGATTCTCCCACTGTGACCGTTTCGCAAATCGCCTTTACTCATTTTCACCTTCTTCTCCAACGGACCCATCGTTGGACCCCGAGTACGCACGGCAGCTAATGGATGCTTGTCCGCAGAAT
GTGGATCCCAGTGTGGCCATCAACATGGACCCTATAACTCCTCAGACCTTTGACAACGTTTATTATCAAAACCTCATCTCTGGCAAAGGCTTATTCACTTCCGATCAGATTCTGTTTACC
GAGTCTGAATCACAACCAACAGTTAGTAGTTTTGCCACCAATGGAGCAGAGTTTAATGCAGCGTTTATCACAGCCATGACCAAGTTAGGTCGAGTTGGGGTTAAGACCGGTAATGATGGT
GAAATTCGAAGGGATTGCACTGCCTTTAATTCCTAA

Retrieve as FASTA