Entry information : CsaPrx32 ( Cucsa.103030.1)
Entry ID 8820
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: CsaPrx32 ( Cucsa.103030.1)
Name (synonym) CsaPrx32 ( Cucsa.103030.1)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx32
start..stop
S start..stop
RcPrx21 535 0 26..329 31..334
LuPrx69 534 0 4..328 17..340
GhPrx26 532 0 20..329 21..330
EgrPrx134 530 0 1..329 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1921448..1921663 216 N° 2 1921755..1921955 201 N° 3 1922033..1922198 166 N° 4 1922296..1922699 404
join(1921448..1921663,1921755..1921955,1922033..1922198,1922296..1922699)


exon

Literature and cross-references CsaPrx32 ( Cucsa.103030.1)
DNA ref. Phytozome 12:   scaffold00927 (1921448..1922699)
Protein sequence: CsaPrx32 ( Cucsa.103030.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   35946.4 (33167.8)  
PI (pH):   %s   9.54 (9.34) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRFNLIVTLSLLSLFLFFPSPTLAQLRQNFYANICPNVENIVRSEVTKKFQQTFVTVPATLRLFFHDCFVQGCDASVIIASTASNKAEKDHPDNLSLAGDGFDTVIKAKAALDAIPQCRNRVSCADILALATRDVIALSGGPSYAVELGRLDGLVSKASDVNGRLPAPTFNLNQLNSLFAANGLTQQDMIALSAAHTVGFSHCGKFSNRIYTFAPGRQVDPTLNRTYATQLQAMCPKNVDPRVAINMDPITPRAFDNVYFRNLQQGMGLFTSDQVLFSDRRSRPTVDTWARDSKAFNKAFIEAMTKLGRVGVKTGRNGNIRRDCGAF

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTTCAATCTCATCGTTACACTCTCTCTTCTTTCTCTCTTTCTCTTCTTCCCTTCCCCAACGCTCGCCCAACTTCGACAAAATTTCTACGCCAACATTTGTCCCAATGTCGAA
AACATTGTCCGCTCTGAAGTTACCAAAAAATTTCAACAAACTTTCGTCACTGTTCCAGCCACTCTTCGCCTCTTCTTCCACGATTGCTTTGTTCAG
GTCAGCCAATTTTCTCTTTCCATT
TATAATTTTTTAGTTACAGAGTACGTAATTTTTGCTTTAATATTTTTTGTGGAAAATGGATTCTTAGGGATGTGATGCCTCTGTAATTATTGCTTCCACCGCATCCAACAAGGCCGAGAA
AGACCATCCCGATAACCTCTCCCTCGCTGGAGATGGATTCGATACCGTCATTAAAGCTAAAGCTGCCCTCGACGCCATTCCTCAATGCCGAAACAGAGTCTCCTGTGCCGATATTCTCGC
TTTAGCCACCCGTGATGTCATCGCATTG
GTCAGTGTAATAATTAAAAACTAAAAAATCCAAAATTATAAATCAAAATCTCACCGCGCTCCGATTCGTAATTCCAGTCCGGCGGACCGTCG
TACGCGGTGGAGCTAGGAAGATTAGACGGTCTGGTTTCTAAAGCCTCGGACGTGAACGGTAGACTCCCAGCACCGACCTTCAATCTGAATCAGCTGAATTCTCTATTTGCAGCGAATGGC
CTCACGCAACAAGACATGATCGCTCTCTCAG
GTGCTCCAATCAAATCCCGCCACCTGTTTATTCCCGTGATCGAAATACTTTGTTTATTATTTGTAACTCTCACATGCATTACTGTACGA
TATGGCAGCCGCTCACACCGTCGGATTCTCACACTGTGGCAAATTCTCGAATCGAATCTACACCTTTGCCCCTGGGAGACAAGTCGACCCTACACTAAACCGAACCTATGCAACGCAGCT
ACAAGCGATGTGCCCCAAGAATGTGGACCCGAGGGTGGCGATTAACATGGACCCAATCACCCCCAGAGCGTTTGACAACGTTTACTTTAGAAATTTACAGCAAGGAATGGGTCTGTTCAC
GTCAGACCAGGTTCTATTCAGCGACCGGCGATCAAGACCCACAGTGGACACGTGGGCTAGAGACTCAAAAGCTTTTAATAAAGCTTTTATTGAAGCTATGACTAAGTTGGGGCGGGTCGG
GGTGAAGACCGGTAGGAATGGTAATATTCGGCGCGATTGTGGAGCGTTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTTCAATCTCATCGTTACACTCTCTCTTCTTTCTCTCTTTCTCTTCTTCCCTTCCCCAACGCTCGCCCAACTTCGACAAAATTTCTACGCCAACATTTGTCCCAATGTCGAA
AACATTGTCCGCTCTGAAGTTACCAAAAAATTTCAACAAACTTTCGTCACTGTTCCAGCCACTCTTCGCCTCTTCTTCCACGATTGCTTTGTTCAG
GGATGTGATGCCTCTGTAATTATT
GCTTCCACCGCATCCAACAAGGCCGAGAAAGACCATCCCGATAACCTCTCCCTCGCTGGAGATGGATTCGATACCGTCATTAAAGCTAAAGCTGCCCTCGACGCCATTCCTCAATGCCGA
AACAGAGTCTCCTGTGCCGATATTCTCGCTTTAGCCACCCGTGATGTCATCGCATTG
TCCGGCGGACCGTCGTACGCGGTGGAGCTAGGAAGATTAGACGGTCTGGTTTCTAAAGCCTCG
GACGTGAACGGTAGACTCCCAGCACCGACCTTCAATCTGAATCAGCTGAATTCTCTATTTGCAGCGAATGGCCTCACGCAACAAGACATGATCGCTCTCTCAG
CCGCTCACACCGTCGGA
TTCTCACACTGTGGCAAATTCTCGAATCGAATCTACACCTTTGCCCCTGGGAGACAAGTCGACCCTACACTAAACCGAACCTATGCAACGCAGCTACAAGCGATGTGCCCCAAGAATGTG
GACCCGAGGGTGGCGATTAACATGGACCCAATCACCCCCAGAGCGTTTGACAACGTTTACTTTAGAAATTTACAGCAAGGAATGGGTCTGTTCACGTCAGACCAGGTTCTATTCAGCGAC
CGGCGATCAAGACCCACAGTGGACACGTGGGCTAGAGACTCAAAAGCTTTTAATAAAGCTTTTATTGAAGCTATGACTAAGTTGGGGCGGGTCGGGGTGAAGACCGGTAGGAATGGTAAT
ATTCGGCGCGATTGTGGAGCGTTTAAT

Retrieve as FASTA