Entry information : SbPrx122 (Sobic.009G144900.1 [2.1] / Sb09g021000 [1.4])
Entry ID 883
Creation 2008-10-20 (Christophe Dunand)
Last sequence changes 2008-10-20 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx122 (Sobic.009G144900.1 [2.1] / Sb09g021000 [1.4])
Name (synonym) SbPrx122 (Sobic.009G144900.1 [2.1] / Sb09g021000 [1.4])
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducers Abscissic acid treatment
Heat shock stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx122
start..stop
S start..stop
SbPrx121 548 0 1..325 1..325
ZmPrx135 521 0 32..323 35..326
SbPrx120 518 0 3..326 2..320
SbPrx124 513 0 3..325 2..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50425988..50426257 270 N° 2 50426369..50426563 195 N° 3 50426725..50426887 163 N° 4 50426997..50427349 353
join(50425988..50426257,50426369..50426563,50426725..50426887,50426997..50427349 )


exon

Literature and cross-references SbPrx122 (Sobic.009G144900.1 [2.1] / Sb09g021000 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_9 (50425988..50427349)
Protein sequence: SbPrx122 (Sobic.009G144900.1 [2.1] / Sb09g021000 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (295)
PWM (Da):   %s   34777.46 (31865.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.5 (5.96) Peptide Signal:   %s   cut: 32 range:32-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSRVSSLGLLLAAHCALLLALAGAAHAHSYAPSGGGGGVALSSAFYDESCPSAYDVVRRVIQDARVSDPRLPASLIRLHFHDCFVNGCDGSLLLDDDLPAIQSEKHAPGNDKSARGFEVVDDIKSALEKACPGVVSCADILALAAEISVELAGGPRWRVLLGRRDGTTTNIEGANNLPSPFDPLNKLQEKFRNFNLDDTDLVALQGAHTFGKVQCQFTQQNCTAGQSGGSLENLDQVTPKVFDNKYYSNLLEGRAQLRSDQVMLSDPSAVVTTAPIVHRFAGNQQDFFRNFAASMIKMGNISPLTGKDGEIRNNCRRVNKRY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCGCTTCCTCTCGCGTCTCGTCTCTCGGGTTGCTGCTAGCCGCGCACTGCGCACTCTTGCTCGCTTTGGCTGGAGCTGCTCACGCTCACAGTTACGCTCCTAGCGGCGGCGGC
GGCGGCGTGGCGCTGAGCTCCGCGTTCTACGACGAGTCGTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGACGCGCGCGTCTCGGACCCGCGCCTCCCGGCAAGCCTCATC
CGCCTCCACTTCCACGACTGCTTCGTCAAT
GTGAGTGCCAACGCTTGCTTCTGCCCGTGGATGAGATGTACGCGGCGCTACGCGGGCAGCTCAGCGCGTTCGTTGCATCATCTGACATGA
ATGAACGTCCAAATGTTTCAGGGTTGCGACGGCTCACTCCTGCTGGACGACGATCTCCCGGCGATCCAGTCCGAGAAACACGCGCCCGGCAACGACAAATCCGCGCGTGGCTTCGAGGTT
GTCGATGACATCAAGAGCGCGCTGGAGAAAGCGTGCCCTGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGTCGAACTC
GTAAGAACCCCATATACCTAGCAA
GGTTTCTACCATTGAACAACTACAGTTTCGTACTAGATAGCTGATAGCTCTAGCTTCCCAATCTTGCTCCACACGTTCATTTTTCCATCTCAACCGAGAACTGACGGAATCATGAACTAC
GTGCTTGCTGCTTGCAGGCTGGTGGGCCGCGATGGAGGGTGTTGCTCGGCCGGCGAGACGGCACGACGACTAACATTGAGGGCGCCAACAACCTACCGAGCCCTTTCGACCCCCTGAACA
AGCTCCAGGAGAAGTTCAGAAACTTCAACCTCGACGACACTGACCTCGTCGCCCTCCAAG
GTAATCTACTTACCGATGTAGCAACACAAACAGTTCAAACTGAGGAAGCTCAAGACAGCG
CGTGCCTTGTCACAAATCTCAACATATATATTTGCTATTTCTAATTCAGGAGCGCACACATTTGGTAAAGTACAGTGCCAGTTCACGCAGCAGAATTGCACGGCCGGCCAGTCCGGCGGC
TCACTGGAGAACCTGGACCAGGTCACGCCCAAGGTGTTCGACAATAAGTATTACAGCAACCTCTTAGAGGGCCGCGCTCAACTCCGGTCCGACCAAGTTATGCTATCGGACCCTTCCGCG
GTGGTGACCACTGCTCCCATTGTTCATCGGTTCGCAGGCAACCAACAGGATTTTTTCAGAAACTTCGCAGCATCAATGATCAAGATGGGAAACATTAGCCCACTAACAGGAAAGGATGGG
GAGATAAGGAACAACTGCCGAAGGGTTAACAAACGCTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCGCTTCCTCTCGCGTCTCGTCTCTCGGGTTGCTGCTAGCCGCGCACTGCGCACTCTTGCTCGCTTTGGCTGGAGCTGCTCACGCTCACAGTTACGCTCCTAGCGGCGGCGGC
GGCGGCGTGGCGCTGAGCTCCGCGTTCTACGACGAGTCGTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGACGCGCGCGTCTCGGACCCGCGCCTCCCGGCAAGCCTCATC
CGCCTCCACTTCCACGACTGCTTCGTCAAT
GGTTGCGACGGCTCACTCCTGCTGGACGACGATCTCCCGGCGATCCAGTCCGAGAAACACGCGCCCGGCAACGACAAATCCGCGCGTGGC
TTCGAGGTTGTCGATGACATCAAGAGCGCGCTGGAGAAAGCGTGCCCTGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGTCGAACTC
GCTGGTGGGCCGCGA
TGGAGGGTGTTGCTCGGCCGGCGAGACGGCACGACGACTAACATTGAGGGCGCCAACAACCTACCGAGCCCTTTCGACCCCCTGAACAAGCTCCAGGAGAAGTTCAGAAACTTCAACCTC
GACGACACTGACCTCGTCGCCCTCCAAG
GAGCGCACACATTTGGTAAAGTACAGTGCCAGTTCACGCAGCAGAATTGCACGGCCGGCCAGTCCGGCGGCTCACTGGAGAACCTGGACCAG
GTCACGCCCAAGGTGTTCGACAATAAGTATTACAGCAACCTCTTAGAGGGCCGCGCTCAACTCCGGTCCGACCAAGTTATGCTATCGGACCCTTCCGCGGTGGTGACCACTGCTCCCATT
GTTCATCGGTTCGCAGGCAACCAACAGGATTTTTTCAGAAACTTCGCAGCATCAATGATCAAGATGGGAAACATTAGCCCACTAACAGGAAAGGATGGGGAGATAAGGAACAACTGCCGA
AGGGTTAACAAACGCTACTAA

Retrieve as FASTA