Entry information : CsaPrx72 (Cucsa.234060.1)
Entry ID 8846
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx72 (Cucsa.234060.1)
Name (synonym) CsaPrx72 (Cucsa.234060.1)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx72
start..stop
S start..stop
RcPrx21 517 0 31..334 31..334
GhPrx26 509 0 27..334 23..330
CsaPrx32 509 0 28..334 23..329
EgrPrx134 508 0 27..334 22..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17489..17719 231 N° 2 17033..17233 201 N° 3 16738..16903 166 N° 4 15743..16152 410
complement(join(15743..16152,16738..16903,17033..17233,17489..17719))


exon

Literature and cross-references CsaPrx72 (Cucsa.234060.1)
DNA ref. Phytozome 11:   scaffold01999 (17719..15743)
Protein sequence: CsaPrx72 (Cucsa.234060.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (305)
PWM (Da):   %s   36543.37 (33310.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.73 (8.56) Peptide Signal:   %s   cut: 31 range:31-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRGIGRMVSSFVGFVLVLTTLLAVVPTTEAQLRRDFYADVCPNVESIVRSAVTKKFKQTFVTVPATLRLFFHDCFVQGCDASVMIASDGSNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPGCKNKVSCADILVMATRDVISLARGPSYAVELGRKDGLVSRASDVEGKLPQPSFNLNQLNAMFAANGLSQADMIALSAAHTVGFSHCSKFANRIYNFSRTNPVDPTINPTYAKKLQDMCPQDVDPRIAIDMDPNTPRRFDNMYFKNLQQGMGLFTSDQILFTDRRSKSTVNIWAHSGRTFYTAFIDAMTKLGRVGVKTGSDGNIRTDCGVFNS

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGGATTGGTAGAATGGTAAGCTCTTTTGTGGGTTTTGTTCTTGTTTTGACAACTTTGTTGGCGGTTGTTCCCACGACCGAGGCGCAGCTCCGACGAGATTTCTATGCCGATGTA
TGCCCTAACGTCGAGAGTATAGTTCGAAGCGCTGTGACAAAGAAGTTCAAACAAACGTTTGTTACTGTTCCTGCTACTCTTCGCCTCTTCTTCCATGACTGCTTTGTTCAG
GTAATTTGC
AATAATAATTAAGTTCTTTGAAGTTTGAAAAGTAAATTTAAATTTAAGTACTAAATGTGTAATTTGAGTTTATAAAAAAAGTAGTTTGTTGGAATTTTCTTAAAAATCGATTAGAAAAAA
AAAGTATTACTCGACTTAAAATGATTTAAATAGTTGCATGAGAAAGGATATGATGTGTATGTTTATATATATATAATGCAATTTAAAGACTAAAAGAGTTTTTTGGGTTTCATTCAATCA
ATGTAGGGATGTGATGCGTCAGTGATGATCGCTTCAGATGGAAGCAACAAGGCAGAGAAGGATCATCCTGATAATCTTTCGTTAGCCGGTGATGGATTCGATACCGTTATCAAAGCTAAA
GCAGCAGTTGATGCTGTACCAGGATGTAAAAACAAAGTCTCATGTGCTGATATTCTCGTCATGGCTACTCGAGATGTCATTTCATTG
GTTCGTAATTGGTGTTGATTTTCTCAACTGATT
AATTAACAACCCTCTCAATATCCTTTGATAACGATTTTGTTTATAGTACGTACGTTCTCAATAACAATCATCGAATTTATTATGATTGGAAAACAGGCGAGAGGACCTTCATATGCAGTG
GAGTTGGGAAGAAAAGATGGGCTCGTTTCCAGGGCTTCAGATGTTGAAGGAAAATTGCCTCAACCATCCTTCAATCTCAATCAACTTAATGCTATGTTTGCTGCCAATGGTCTTTCTCAA
GCTGACATGATTGCTCTCTCTG
GTATTTATACTTTTAATTTCCTTTTTCCCTTACATTTCTAATTGTTGGACGAATTCACAGTTGGTTATTATAGTCCATACATGATTACTATTGTACCA
AATTTAGTTATGTCAAATTAAAGTTAATTTTACTAAAACTAGACGACTCTTAAACTTTCATAATCGCTTAAGTCATCGTTGTTTGATAGTTTTAGTTTTTAAACCTTAGACAAATATTGA
TTAGGTCTAGGGATGGAGCTCGAGCCCGACCTCACGATCTCTCTTGAAATTTGAATTGTTATAAATAATATTAACAATAACATGTTTTTCAAAGATATTATGTTAGCATAGTGATTTTAG
GTGTCTTTAACTAAGAGTATTTTTAGAGGATAATTAAATGTGAACACCAACCTTTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCAGCGAATACTTATGATTTAATTGATATATTTGTAA
CTTGCAGCGGCACACACGGTAGGATTCTCCCATTGCAGTAAGTTTGCAAACAGAATCTACAATTTCAGTCGTACAAATCCAGTTGATCCAACGATAAATCCGACGTATGCAAAAAAGCTT
CAAGATATGTGTCCCCAAGATGTGGATCCAAGGATAGCCATTGACATGGATCCCAACACCCCCAGAAGGTTTGATAATATGTACTTCAAAAATCTTCAACAAGGAATGGGCCTTTTCACT
TCTGACCAAATCCTCTTCACTGACCGAAGGTCTAAGTCCACTGTCAACATTTGGGCACATAGTGGTAGAACCTTCTACACAGCCTTTATTGATGCCATGACCAAGTTGGGTCGAGTCGGT
GTTAAGACCGGATCCGATGGTAACATTCGTACTGATTGTGGTGTTTTCAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGGATTGGTAGAATGGTAAGCTCTTTTGTGGGTTTTGTTCTTGTTTTGACAACTTTGTTGGCGGTTGTTCCCACGACCGAGGCGCAGCTCCGACGAGATTTCTATGCCGATGTA
TGCCCTAACGTCGAGAGTATAGTTCGAAGCGCTGTGACAAAGAAGTTCAAACAAACGTTTGTTACTGTTCCTGCTACTCTTCGCCTCTTCTTCCATGACTGCTTTGTTCAG
GGATGTGAT
GCGTCAGTGATGATCGCTTCAGATGGAAGCAACAAGGCAGAGAAGGATCATCCTGATAATCTTTCGTTAGCCGGTGATGGATTCGATACCGTTATCAAAGCTAAAGCAGCAGTTGATGCT
GTACCAGGATGTAAAAACAAAGTCTCATGTGCTGATATTCTCGTCATGGCTACTCGAGATGTCATTTCATTG
GCGAGAGGACCTTCATATGCAGTGGAGTTGGGAAGAAAAGATGGGCTC
GTTTCCAGGGCTTCAGATGTTGAAGGAAAATTGCCTCAACCATCCTTCAATCTCAATCAACTTAATGCTATGTTTGCTGCCAATGGTCTTTCTCAAGCTGACATGATTGCTCTCTCTG
CG
GCACACACGGTAGGATTCTCCCATTGCAGTAAGTTTGCAAACAGAATCTACAATTTCAGTCGTACAAATCCAGTTGATCCAACGATAAATCCGACGTATGCAAAAAAGCTTCAAGATATG
TGTCCCCAAGATGTGGATCCAAGGATAGCCATTGACATGGATCCCAACACCCCCAGAAGGTTTGATAATATGTACTTCAAAAATCTTCAACAAGGAATGGGCCTTTTCACTTCTGACCAA
ATCCTCTTCACTGACCGAAGGTCTAAGTCCACTGTCAACATTTGGGCACATAGTGGTAGAACCTTCTACACAGCCTTTATTGATGCCATGACCAAGTTGGGTCGAGTCGGTGTTAAGACC
GGATCCGATGGTAACATTCGTACTGATTGTGGTGTTTTCAACTCTTGA

Retrieve as FASTA