Entry information : CsaPrx85 (Cucsa.311010.1)
Entry ID 8854
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: CsaPrx85 (Cucsa.311010.1)
Name (synonym) CsaPrx85 (Cucsa.311010.1)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx85
start..stop
S start..stop
GmPrx59 479 4e-172 16..323 19..326
CpapPrx62 476 6e-171 22..323 30..331
CpapPrx22 470 2e-168 20..323 20..323
RcPrx06 469 3e-168 20..323 26..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 683177..683377 201 N° 2 682866..683063 198 N° 3 682543..682708 166 N° 4 682053..682456 404
complement(join(682053..682456,682543..682708,682866..683063,683177..683377))


exon

Literature and cross-references CsaPrx85 (Cucsa.311010.1)
DNA ref. Phytozome 12:   scaffold02995 (683377..682053)
Protein sequence: CsaPrx85 (Cucsa.311010.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323
PWM (Da):   %s   34789.46  
PI (pH):   %s   9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKIQFxxxxxxxxxSICCFAQLHLNFYQNSCPNVESIVRAAVKQKFEQTFVTAPATLRLFFHDCFVRGCDASVLIQTNNHTSEKDNAENLSLAGDGFDTVIKAKAAVDSVPGCKNKVSCADILALATRDVVALTGGPSYAVELGRRDGQISTRKSVRHHLPKPDFGLNQLNAMFAKHGLTQTDMIALSGAHTIGFSHCKHFSKRLYSFHSKNRIDPTFNPTYVDELKRECPRNVDQRIAIDMDSTSSFTFDNMYFKNLQMGKGLFTSDQVLFTDPRSRKTVNLFASNNTAFEQAFVVAMTKLGRVGVKTKNQGEIRIDCSSVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCCAATTCTNNNNNNNNNNNNNNNNNNNNNNNNATTCAATTTGCTGTTTTGCTCAGCTTCACCTCAATTTTTATCAAAATTCATGCCCAAATGTTGAGTCCATTGTTAGAGCT
GCAGTGAAACAGAAATTTGAACAGACTTTTGTCACTGCCCCTGCCACTCTAAGGCTCTTCTTCCATGACTGTTTTGTTAGG
GTATTCCTAAACTCCTCTTTCTTGTTTCTTTGATGAGAA
TTCTTTTACATTTTGATGAATTTGAGAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGACAGGGTTGTGATGCTTCTGTGTTGATCCAAACAAATAACCACACTTCTG
AGAAAGATAATGCAGAGAATCTTTCGCTCGCCGGAGACGGTTTCGACACTGTGATCAAAGCTAAGGCTGCTGTGGATAGCGTGCCAGGATGTAAGAATAAGGTTTCTTGTGCTGACATTT
TGGCTTTGGCTACTAGAGATGTTGTAGCTTTG
GTAAGTAACTTCTGAATATCGAACCACTTGGTGTGTCACAAGCCAGTTCTTAAGAGCAAAAAGCTTTCTTTGAGTTATGTTACTTGGT
GTTTGTCCATGTAGAATCATGTCTTGTTCATTCAGTAGTTGGACTTAGGGAGTTGTTGTTATCTTGCAGACGGGAGGACCGTCATATGCCGTGGAGTTAGGAAGACGAGATGGGCAAATC
TCGACAAGAAAGAGTGTTCGACATCACCTTCCTAAGCCTGATTTTGGATTAAATCAACTCAATGCTATGTTTGCAAAACATGGTCTAACTCAAACAGACATGATTGCTCTCTCAG
GTAAG
AGAGAGCTTTGAATAATTTTGGAAAAGGTAAAATACAATTGGATTCTAGTTTTGATGAATTTGTATTGTTGTTTCTTTTAGGTGCACATACAATTGGATTCTCACATTGCAAGCACTTCT
CCAAAAGGCTATACAGTTTCCACAGCAAAAACAGAATTGACCCGACGTTTAATCCAACGTATGTCGATGAGCTCAAGAGGGAATGCCCGAGAAACGTCGACCAGAGAATTGCGATCGACA
TGGACTCAACGTCGTCGTTCACATTCGACAACATGTACTTTAAGAATCTGCAGATGGGAAAAGGATTGTTCACCTCAGACCAAGTGTTGTTCACAGATCCAAGATCAAGAAAAACAGTGA
ACTTATTTGCTTCCAACAATACAGCTTTTGAGCAAGCTTTTGTAGTTGCAATGACAAAGCTTGGGAGAGTTGGAGTCAAAACAAAAAACCAAGGAGAGATCAGAATTGATTGTTCATCAG
TGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCCAATTCTNNNNNNNNNNNNNNNNNNNNNNNNATTCAATTTGCTGTTTTGCTCAGCTTCACCTCAATTTTTATCAAAATTCATGCCCAAATGTTGAGTCCATTGTTAGAGCT
GCAGTGAAACAGAAATTTGAACAGACTTTTGTCACTGCCCCTGCCACTCTAAGGCTCTTCTTCCATGACTGTTTTGTTAGG
GGTTGTGATGCTTCTGTGTTGATCCAAACAAATAACCAC
ACTTCTGAGAAAGATAATGCAGAGAATCTTTCGCTCGCCGGAGACGGTTTCGACACTGTGATCAAAGCTAAGGCTGCTGTGGATAGCGTGCCAGGATGTAAGAATAAGGTTTCTTGTGCT
GACATTTTGGCTTTGGCTACTAGAGATGTTGTAGCTTTG
ACGGGAGGACCGTCATATGCCGTGGAGTTAGGAAGACGAGATGGGCAAATCTCGACAAGAAAGAGTGTTCGACATCACCTT
CCTAAGCCTGATTTTGGATTAAATCAACTCAATGCTATGTTTGCAAAACATGGTCTAACTCAAACAGACATGATTGCTCTCTCAG
GTGCACATACAATTGGATTCTCACATTGCAAGCAC
TTCTCCAAAAGGCTATACAGTTTCCACAGCAAAAACAGAATTGACCCGACGTTTAATCCAACGTATGTCGATGAGCTCAAGAGGGAATGCCCGAGAAACGTCGACCAGAGAATTGCGATC
GACATGGACTCAACGTCGTCGTTCACATTCGACAACATGTACTTTAAGAATCTGCAGATGGGAAAAGGATTGTTCACCTCAGACCAAGTGTTGTTCACAGATCCAAGATCAAGAAAAACA
GTGAACTTATTTGCTTCCAACAATACAGCTTTTGAGCAAGCTTTTGTAGTTGCAATGACAAAGCTTGGGAGAGTTGGAGTCAAAACAAAAAACCAAGGAGAGATCAGAATTGATTGTTCA
TCAGTGAAC

Retrieve as FASTA