Entry information : CsPrx13 (orange1.1g036989m/Cs2g05220)
Entry ID 8865
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-01-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx13 (orange1.1g036989m/Cs2g05220)
Name (synonym) CsPrx13 (orange1.1g036989m/Cs2g05220)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx13
start..stop
S start..stop
CppPrx08 689 0 19..355 18..354
CclPrx92 688 0 19..355 20..356
RcPrx49 581 0 17..354 16..352
MePrx10 579 0 17..354 18..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 426747..427034 288 N° 2 426413..426613 201 N° 3 425125..425703 579  
complement(join(425125..425703,426413..426613,426747..427034))


exon

Literature and cross-references CsPrx13 (orange1.1g036989m/Cs2g05220)
DNA ref. Citrus sinensis Annotation Project:   chr2 (2774101..2776012) Phytozome 12:   scaffold00007 (426923..425128)
Protein sequence: CsPrx13 (orange1.1g036989m/Cs2g05220)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (319)
PWM (Da):   %s   38968.12 (35092.1) Transmb domain:   %s   o15-37i
PI (pH):   %s   9.12 (9.47) Peptide Signal:   %s   cut: 37 range:37-355
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVPSPPPPPPCSSFPFVLACLLIFSLILNTPCILAAKTNNNNARSSRRQLSVDYYAKSCPQLEQLVGSVTSQQFKEAPVSGPATIRLFFHDCFVEGCDGSILIATKPGSKELAEKDALGNKDLRVEGFESIRKAKALVESKCPGVVSCADILAIAARDYVHLAGGPYYQVKKGRWDGKISMASRVPFNLPRANSTIDQIIKIFNAKGLTIEDMVVLSGAHTIGFAHCEHFVSRLYDYRGTKQPDPAIDPRLLRALRMACPHFGGNTDIVAPFDVTTPFLFDHAYYANLEGKLGLLASDQVLFLDPRTKSLVQELGKDKQKFFQAFAVAMEKMGSIGVKRGRKHGEKRKDCSMHL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGTCCCATCTCCTCCTCCTCCTCCTCCTTGTTCTTCATTTCCTTTTGTTTTGGCTTGCTTGCTCATTTTTTCGCTTATTCTCAACACACCATGTATTTTAGCAGCCAAAACTAAT
AATAATAATGCTCGCAGCAGCAGACGCCAACTCTCAGTTGATTACTATGCAAAATCTTGCCCTCAACTTGAGCAACTTGTAGGTTCAGTAACCAGCCAACAGTTCAAAGAAGCACCCGTT
TCTGGTCCAGCCACCATTCGCCTCTTTTTCCATGACTGCTTTGTAGAA
GTAAAGTATTTTTTTTTTAATTTTAATTTGCATGCATGCACATTTCGCTAGTAGTACTATGTAATAACCTCT
ACCAGAACTACCATCAACCTGGTACATTATTGATTTTTTTTTCTCTCGTTTTTTATTGAAGGGCTGTGATGGGTCTATTTTGATAGCGACCAAGCCTGGCAGCAAAGAGTTAGCAGAGAA
GGATGCATTGGGTAACAAGGACTTGCGGGTAGAGGGATTTGAAAGCATAAGGAAAGCAAAGGCCTTGGTGGAGAGCAAGTGCCCTGGTGTTGTATCTTGTGCAGACATTCTTGCAATTGC
AGCCAGAGATTATGTCCATTTG
GTCAGTAAATTCTCCTTTTCGGTTCTAGCTGATTCTTTCAGATTCGTTCCAATCGCATTCATATGCTTAATTAGTTGCCTCTTGAGTAAAAAAGAAAA
AAAAATCAAGTAGCAGATAAATTTCTAATGGGATATATTAAGGCTCATTTGATTTATTACAACTATATAATCCGAGTTATTAGATAAAGACACTTTGAATGCTTGCTTTCTTCCAATATT
TTGTTTAAAAGGTTAAAAAAAAAAAAAGACTCTGTAAAGTTGCCATAAAAGCAAAGCAGACTCCACTAATAGTTCCTCTGATTCTTGGTAAATAATAGAGACATTCAACTTCTCACTGGC
TATTCTCTCATTTCTCTGAACTAGCTTAGTACTATTTTCTGATATTGACGATGCTTCCAAAGTAGAAAGATTTTAGAGAAAAATTGTTGTCTCATTTTCCACTAAACAACCAAACTTAAC
AAGCTGTTTTCAACAGGACAAAAACAGAGAAATACATATTTCCATGTGCCCAATTTGTCTGCTAATGATATATTTTGTCGTAAGCTGATCCTGACTATCAATATATTTATTTAATTTTAG
TTATCCAAAGACGTAATTAAATCATTTCACCGTAAATGCCAAGACCATTTTTGCTTTTGTTATTATTGTTTGAAATTGATGTAACATCCTATCTTCATAACCTTAGAGAAATATTCAAAA
TATTGTTGCAGGCTGGGGGTCCTTATTACCAAGTTAAGAAAGGGAGATGGGATGGGAAAATATCAATGGCGTCAAGGGTACCCTTCAATTTGCCGCGTGCAAATTCCACCATTGATCAAA
TTATCAAAATCTTCAACGCAAAAGGGCTGACAATTGAAGACATGGTGGTTCTTTCTGGAGCGCACACAATTGGATTTGCTCATTGTGAGCACTTTGTGAGCAGACTATATGATTATCGTG
GCACAAAGCAGCCTGACCCTGCCATTGATCCAAGGCTACTGAGGGCTCTGAGAATGGCATGTCCACATTTTGGTGGCAATACTGACATTGTCGCACCGTTTGATGTTACCACACCATTTT
TGTTTGACCATGCTTATTATGCTAACTTGGAGGGGAAATTGGGCTTGTTGGCATCAGACCAAGTTTTGTTTTTGGACCCAAGGACCAAGTCTTTGGTTCAGGAATTGGGCAAGGATAAGC
AGAAATTCTTCCAAGCTTTCGCTGTAGCTATGGAGAAAATGGGCTCAATAGGTGTTAAAAGAGGGAGAAAACATGGCGAGAAAAGAAAAGATTGTAGCATGCACTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGTCCCATCTCCTCCTCCTCCTCCTCCTTGTTCTTCATTTCCTTTTGTTTTGGCTTGCTTGCTCATTTTTTCGCTTATTCTCAACACACCATGTATTTTAGCAGCCAAAACTAAT
AATAATAATGCTCGCAGCAGCAGACGCCAACTCTCAGTTGATTACTATGCAAAATCTTGCCCTCAACTTGAGCAACTTGTAGGTTCAGTAACCAGCCAACAGTTCAAAGAAGCACCCGTT
TCTGGTCCAGCCACCATTCGCCTCTTTTTCCATGACTGCTTTGTAGAA
GGCTGTGATGGGTCTATTTTGATAGCGACCAAGCCTGGCAGCAAAGAGTTAGCAGAGAAGGATGCATTGGGT
AACAAGGACTTGCGGGTAGAGGGATTTGAAAGCATAAGGAAAGCAAAGGCCTTGGTGGAGAGCAAGTGCCCTGGTGTTGTATCTTGTGCAGACATTCTTGCAATTGCAGCCAGAGATTAT
GTCCATTTG
GCTGGGGGTCCTTATTACCAAGTTAAGAAAGGGAGATGGGATGGGAAAATATCAATGGCGTCAAGGGTACCCTTCAATTTGCCGCGTGCAAATTCCACCATTGATCAAATT
ATCAAAATCTTCAACGCAAAAGGGCTGACAATTGAAGACATGGTGGTTCTTTCTGGAGCGCACACAATTGGATTTGCTCATTGTGAGCACTTTGTGAGCAGACTATATGATTATCGTGGC
ACAAAGCAGCCTGACCCTGCCATTGATCCAAGGCTACTGAGGGCTCTGAGAATGGCATGTCCACATTTTGGTGGCAATACTGACATTGTCGCACCGTTTGATGTTACCACACCATTTTTG
TTTGACCATGCTTATTATGCTAACTTGGAGGGGAAATTGGGCTTGTTGGCATCAGACCAAGTTTTGTTTTTGGACCCAAGGACCAAGTCTTTGGTTCAGGAATTGGGCAAGGATAAGCAG
AAATTCTTCCAAGCTTTCGCTGTAGCTATGGAGAAAATGGGCTCAATAGGTGTTAAAAGAGGGAGAAAACATGGCGAGAAAAGAAAAGATTGTAGCATGCACTTGTAG

Retrieve as FASTA