Entry information : CsPrx45 (orange1.1g038520m)
Entry ID 8866
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-01-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx45 (orange1.1g038520m)
Name (synonym) CsPrx45 (orange1.1g038520m)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx45
start..stop
S start..stop
CclPrx118 660 0 1..324 12..335
PtPrx17 504 0 1..324 11..337
MePrx62 484 3e-174 1..324 10..335
RcPrx48 481 1e-172 1..324 11..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1127598..1127816 219 N° 2 1127902..1128093 192 N° 3 1128175..1128735 561  
join(1127598..1127816,1127902..1128093,1128175..1128735)


exon

Literature and cross-references CsPrx45 (orange1.1g038520m)
DNA ref. Phytozome 12:   scaffold00016 (1127598..1128735)
Protein sequence: CsPrx45 (orange1.1g038520m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324
PWM (Da):   %s   34798.13  
PI (pH):   %s   4.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLKIVTTFAIPPKTLKEACIGEIGFELQFNIYNDSCPEAEAIIFSWVENAVMEDSRMAASLLRLHFHDCFVNGCDASVLLDDTGDFVGEKTAPPNLNSLRGFEVIDAIKSDLESVCPETVSCADILAVAARDSVVLTAGPSWEVPMGRRDSFSANKAAATNGIPAPNSSLADLVAKFQNVGLTLQDMVALSGAHTMGKARCLTFSSRLQSSSNTNGPDNNPDFLQSLQQLCSGSDIDALAQLDLVTPATFDNQYYINLLSGEGLLPSDQILVSQDQTREIINSYAEDTSVFFEDFKISMLKMGSLGPASGNDGQIRRNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from Phytozome (splicing error intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTACTTAAGATTGTAACCACATTTGCAATCCCACCAAAAACTTTGAAAGAAGCATGTATTGGGGAAATTGGCTTTGAATTGCAATTTAACATTTACAATGATAGCTGCCCAGAGGCA
GAGGCTATAATCTTTTCTTGGGTTGAAAATGCTGTTATGGAAGATTCAAGAATGGCGGCGTCACTGCTTCGTCTTCATTTTCATGATTGCTTTGTCAAT
GCAAGTCGTCTCCGTATTTAT
TTATATTTCTGTCATCTATTATGTATATTGATTTATAATGTTATGGCATTTGAAGTTCATGCAGGGTTGTGATGCTTCAGTGCTGTTAGATGACACCGGGGACTTTGTTGGAGAAAAAAC
TGCACCACCTAATCTGAATTCACTGAGAGGATTCGAAGTCATAGATGCAATAAAATCTGATCTTGAATCTGTTTGTCCTGAGACTGTGTCTTGTGCTGACATTCTCGCAGTTGCGGCAAG
AGACTCAGTTGTTTTA
GTATGTGATGTTCCATCCACTTTGTGCTCCACCATAATGATAATATTTCCAGTTCCGCTGAAACTGAAATGTATTTTGCAGACTGCTGGTCCAAGCTGGGAAGT
GCCAATGGGCAGGCGAGATAGCTTTAGTGCAAACAAAGCTGCAGCAACCAACGGCATCCCAGCTCCAAATTCTAGTCTCGCAGATCTCGTGGCCAAGTTCCAGAACGTTGGCCTCACGCT
GCAAGACATGGTTGCCCTTTCTGGTGCGCACACGATGGGAAAGGCTCGATGCTTGACTTTCAGCTCCAGGCTACAAAGCAGCAGCAACACAAATGGTCCAGACAATAATCCAGACTTCCT
TCAAAGTCTACAGCAGCTTTGCTCGGGATCCGACATCGATGCACTTGCACAGCTTGATCTGGTGACCCCCGCAACATTCGACAACCAGTACTACATTAACCTTCTTTCTGGAGAGGGGTT
ACTTCCATCCGATCAAATTCTCGTGAGCCAAGATCAAACACGCGAAATCATTAATTCATATGCCGAGGACACGTCCGTTTTCTTTGAGGATTTTAAGATTTCTATGTTGAAGATGGGAAG
CCTGGGGCCTGCGTCCGGAAATGATGGTCAAATTCGTCGCAACTGTCGCGTGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTACTTAAGATTGTAACCACATTTGCAATCCCACCAAAAACTTTGAAAGAAGCATGTATTGGGGAAATTGGCTTTGAATTGCAATTTAACATTTACAATGATAGCTGCCCAGAGGCA
GAGGCTATAATCTTTTCTTGGGTTGAAAATGCTGTTATGGAAGATTCAAGAATGGCGGCGTCACTGCTTCGTCTTCATTTTCATGATTGCTTTGTCAAT
GGTTGTGATGCTTCAGTGCTG
TTAGATGACACCGGGGACTTTGTTGGAGAAAAAACTGCACCACCTAATCTGAATTCACTGAGAGGATTCGAAGTCATAGATGCAATAAAATCTGATCTTGAATCTGTTTGTCCTGAGACT
GTGTCTTGTGCTGACATTCTCGCAGTTGCGGCAAGAGACTCAGTTGTTTTA
ACTGCTGGTCCAAGCTGGGAAGTGCCAATGGGCAGGCGAGATAGCTTTAGTGCAAACAAAGCTGCAGCA
ACCAACGGCATCCCAGCTCCAAATTCTAGTCTCGCAGATCTCGTGGCCAAGTTCCAGAACGTTGGCCTCACGCTGCAAGACATGGTTGCCCTTTCTGGTGCGCACACGATGGGAAAGGCT
CGATGCTTGACTTTCAGCTCCAGGCTACAAAGCAGCAGCAACACAAATGGTCCAGACAATAATCCAGACTTCCTTCAAAGTCTACAGCAGCTTTGCTCGGGATCCGACATCGATGCACTT
GCACAGCTTGATCTGGTGACCCCCGCAACATTCGACAACCAGTACTACATTAACCTTCTTTCTGGAGAGGGGTTACTTCCATCCGATCAAATTCTCGTGAGCCAAGATCAAACACGCGAA
ATCATTAATTCATATGCCGAGGACACGTCCGTTTTCTTTGAGGATTTTAAGATTTCTATGTTGAAGATGGGAAGCCTGGGGCCTGCGTCCGGAAATGATGGTCAAATTCGTCGCAACTGT
CGCGTGGTTAAT

Retrieve as FASTA